Biotin Anti-GFP antibody (ab6658)
Key features and details
- Biotin Goat polyclonal to GFP
- Suitable for: WB, IP, ICC/IF, Sandwich ELISA, IHC-P, IHC-Fr
- Reacts with: Drosophila melanogaster, Species independent
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-GFP antibody
See all GFP primary antibodies -
Description
Biotin Goat polyclonal to GFP -
Host species
Goat -
Conjugation
Biotin -
Specificity
Antibody recognizes wild type, recombinant and enhanced forms of GFP (EGFP). No reaction was observed against Human, Mouse and Rat Serum Proteins. -
Tested Applications & Species
See all applications and species dataApplication Species IHC-Fr Species independentIHC-P Species independent
-
Immunogen
Recombinant full length protein corresponding to GFP aa 1-246.
Sequence:MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYN SHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVL LPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
Database link: P42212 -
General notes
Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation.
Biotinamidocaproate N-Hydroxysuccinimide Ester (BAC) Biotin/Protein Ratio: 10-20 BAC molecules per goat IgG molecule.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.01% Sodium azide
Constituents: 0.44% Potassium phosphate, 0.88% Sodium chloride
10 mg/mL BSA, immunoglobulin and protease free -
Concentration information loading... -
Purity
Affinity purified -
Purification notes
This product was prepared from monospecific antiserum by immunoaffinity chromatography using Green Fluorescent Protein (Aequorea victoria) coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. -
Primary antibody notes
Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Biotin Anti-GFP antibody (ab6658)Biotin Anti-GFP antibody (ab6658)
Additional bands at: 28 kDa. We are unsure as to the identity of these extra bands.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-GFP antibody (ab6658) This image is a courtesy of Hongwei Shaoab6658 staining GFP in human melanoma cells recovered from nude mice by Immunocytochemistry/ immunoflurescence. Cells were fixed with formaldehyde, permeabilized with 0.25% Triton X-100 RT for 10min and blocking with commercially available blocking buffer was performed for 30 minutes at RT. Samples were incubated with primary antibody (1:50) for 18 hours at 4°C. An Alexa Fluor®488-conjugated donkey polyclonal to goat IgG was used as secondary antibody at 1/100 dilution. Green color indicates GFP/Fibrolast cells, while red color indicates Ki67 positive cells, most of them are tumor cells (Abcam`s ab15580 was used for the detection).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-GFP antibody (ab6658)Immunofluorescence Microscopy using ab6658. Tissue: Drosophila melanogaster late stage embryonic central nervous system. Fixation: 0.5% PFA. Antigen retrieval: not required. Primary antibody: Anti-GFP antibody at a 1/1,000 for 1 h at RT. Secondary antibody: AlexaFluor 488™ conjugated anti-Goat antibody at 1/300 for 45 min at RT. Panel A: shows a lateral view (ventral left). Panels B and C: shows ventral views of whole mount embryos at 63x magnification (plus 2x digital zoom). In all panels, anterior is up. Staining: tau-GFP cell bodies (large arrowhead) and axons of motorneurons (arrow) and interneurons (small arrowhead) as green fluorescent signal.
-
Immunohistochemistry (Frozen sections) - Biotin Anti-GFP antibody (ab6658)Immunofluorescence Microscopy using ab6658. Tissue: Sf-1:Cre mice crossed to the Z/EG reporter line. Mouse brain (coronal view, 20X magnification). Fixation: 4%PFA/PBS with o/n fixation, and subsequently transferred to a 30% sucrose solution. Antigen retrieval: frozen in OCT freezing medium (Sakura) and cryostat sectioned at 40 microns. Primary antibody: Goat anti- GFP was used at 1/500 dilution in free floating imunnohistochemistry to detect GFP. Secondary antibody: Fluorchrome conjugated Anti-goat IgG secondary antibody was used for detection at 1:10,000 for 45 min at RT.Localization: Sf-1+ neurons and their processes of the ventromedial nucleus of the hypothalamus. Staining: eGFP as green fluorescent signal and sections were counterstained with DAPI.
-
Immunocytochemistry/ Immunofluorescence - Biotin Anti-GFP antibody (ab6658) Image courtesy of Efrat Shema by Abreview.ab6658 staining GFP in rat brain cells infected with viruses containing GFP under a CMV promoter by Immunocytochemistry/ Immunofluorescence.Cells were fixed with formaldehyde, permeabilized using 0.2% Triton, blocked with 20% serum and then incubated with ab6658 at a 1:50 dilution for 20 hours at 25°C. The secondary used was an Alexa-Fluor 488 conjugated rabbit polyclonal, used at a 1/200 dilution.
