Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Antibodies gfp

Biotin Anti-GFP antibody (ab6658)

Price and availability

328 339 ₸

Availability

Order now and get it on Thursday March 04, 2021

Biotin Anti-GFP antibody (ab6658)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Biotin Goat polyclonal to GFP
  • Suitable for: WB, IP, ICC/IF, Sandwich ELISA, IHC-P, IHC-Fr
  • Reacts with: Drosophila melanogaster, Species independent
  • Conjugation: Biotin
  • Isotype: IgG

You may also be interested in

Product image
Alexa Fluor® 488 Anti-GFP VHH Single Domain antibody (ab192863)
Product image
Recombinant A. victoria GFP protein (ab84191)
Product image
Anti-GFP antibody [EPR14104-89] (ab183735)
Product image
Anti-GFP antibody [E385] - BSA and Azide free (ab239807)

Overview

  • Product name

    Biotin Anti-GFP antibody
    See all GFP primary antibodies
  • Description

    Biotin Goat polyclonal to GFP
  • Host species

    Goat
  • Conjugation

    Biotin
  • Specificity

    Antibody recognizes wild type, recombinant and enhanced forms of GFP (EGFP). No reaction was observed against Human, Mouse and Rat Serum Proteins.
  • Tested Applications & Species

    Application Species
    IHC-Fr
    Species independent
    IHC-P
    Species independent
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to GFP aa 1-246.
    Sequence:

    MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTL VTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNYN SHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLAD HYQQNTPIGDGPVL LPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK


    Database link: P42212
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation.

    Biotinamidocaproate N-Hydroxysuccinimide Ester (BAC) Biotin/Protein Ratio: 10-20 BAC molecules per goat IgG molecule.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.01% Sodium azide
    Constituents: 0.44% Potassium phosphate, 0.88% Sodium chloride

    10 mg/mL BSA, immunoglobulin and protease free
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    This product was prepared from monospecific antiserum by immunoaffinity chromatography using Green Fluorescent Protein (Aequorea victoria) coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities.
  • Primary antibody notes

    Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Fusion / Marker Proteins
    • GFP

Images

  • Western blot - Biotin Anti-GFP antibody (ab6658)
    Western blot - Biotin Anti-GFP antibody (ab6658)
    Biotin Anti-GFP antibody (ab6658)
    Additional bands at: 28 kDa. We are unsure as to the identity of these extra bands.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-GFP antibody (ab6658)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-GFP antibody (ab6658) This image is a courtesy of Hongwei Shao

    ab6658 staining GFP in human melanoma cells recovered from nude mice by Immunocytochemistry/ immunoflurescence. Cells were fixed with formaldehyde, permeabilized with 0.25% Triton X-100 RT for 10min and blocking with commercially available blocking buffer was performed for 30 minutes at RT. Samples were incubated with primary antibody (1:50) for 18 hours at 4°C. An Alexa Fluor®488-conjugated donkey polyclonal to goat IgG was used as secondary antibody at 1/100 dilution. Green color indicates GFP/Fibrolast cells, while red color indicates Ki67 positive cells, most of them are tumor cells (Abcam`s ab15580 was used for the detection).

    See Abreview

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-GFP antibody (ab6658)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-GFP antibody (ab6658)

    Immunofluorescence Microscopy using ab6658. Tissue: Drosophila melanogaster late stage embryonic central nervous system. Fixation: 0.5% PFA. Antigen retrieval: not required. Primary antibody: Anti-GFP antibody at a 1/1,000 for 1 h at RT. Secondary antibody: AlexaFluor 488™ conjugated anti-Goat antibody at 1/300 for 45 min at RT. Panel A: shows a lateral view (ventral left). Panels B and C: shows ventral views of whole mount embryos at 63x magnification (plus 2x digital zoom). In all panels, anterior is up. Staining: tau-GFP cell bodies (large arrowhead) and axons of motorneurons (arrow) and interneurons (small arrowhead) as green fluorescent signal.

  • Immunohistochemistry (Frozen sections) - Biotin Anti-GFP antibody (ab6658)
    Immunohistochemistry (Frozen sections) - Biotin Anti-GFP antibody (ab6658)

    Immunofluorescence Microscopy using ab6658. Tissue: Sf-1:Cre mice crossed to the Z/EG reporter line. Mouse brain (coronal view, 20X magnification). Fixation: 4%PFA/PBS with o/n fixation, and subsequently transferred to a 30% sucrose solution. Antigen retrieval: frozen in OCT freezing medium (Sakura) and cryostat sectioned at 40 microns. Primary antibody: Goat anti- GFP was used at 1/500 dilution in free floating imunnohistochemistry to detect GFP. Secondary antibody: Fluorchrome conjugated Anti-goat IgG secondary antibody was used for detection at 1:10,000 for 45 min at RT.Localization: Sf-1+ neurons and their processes of the ventromedial nucleus of the hypothalamus. Staining: eGFP as green fluorescent signal and sections were counterstained with DAPI.

  • Immunocytochemistry/ Immunofluorescence - Biotin Anti-GFP antibody (ab6658)
    Immunocytochemistry/ Immunofluorescence - Biotin Anti-GFP antibody (ab6658) Image courtesy of Efrat Shema by Abreview.

    ab6658 staining GFP in rat brain cells infected with viruses containing GFP under a CMV promoter by Immunocytochemistry/ Immunofluorescence.Cells were fixed with formaldehyde, permeabilized using 0.2% Triton, blocked with 20% serum and then incubated with ab6658 at a 1:50 dilution for 20 hours at 25°C. The secondary used was an Alexa-Fluor 488 conjugated rabbit polyclonal, used at a 1/200 dilution.

    See Abreview

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Biotin Anti-GFP antibody (ab6658)

  •  
  • Product image

    Anti-GFP antibody [E385] - BSA and Azide free (ab239807)

    Applications: WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104] (ab183734)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    HRP Anti-GFP antibody [E385] (ab190584)

    Applications: WB

  •  
  • Product image

    Anti-GFP antibody [E385] (ab32146)

    Applications: WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104-89] (ab183735)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104] - BSA and Azide free (ab220802)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104-89] - BSA and Azide free (ab236117)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.