Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)
![Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)](https://www.abcam.com/ps/products/181/ab181491/Images/ab181491-210902-anti-cytokeratin-5-antibody-10c11e6-western-blot.jpg "Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)")
Key features and details
- Mouse monoclonal [10C11E6] to Cytokeratin 5
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Cytokeratin 5 antibody [10C11E6]
See all Cytokeratin 5 primary antibodies -
Description
Mouse monoclonal [10C11E6] to Cytokeratin 5 -
Host species
Mouse -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Chimpanzee
-
Immunogen
Recombinant fragment corresponding to Human Cytokeratin 5 aa 316-590. (Expressed in E.coli).
Sequence:THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKY EELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIA DAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDV EIATYRKLLEGEECRLSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGG LGGGLGGGLAGGSSGSYYSSSSGGVGLGGGLSVGGSGFSA SSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS
Database link: P13647 -
Positive control
- Human Cytokeratin 5 recombinant protein; A431 cell lysate; Human bladder cancer and esophagus cancer tissues.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
10C11E6 -
Isotype
IgG1 -
Research areas
Images
-
Western blot - Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)Anti-Cytokeratin 5 antibody [10C11E6] (ab181491) at 1/500 dilution + A431 cell lysate
Predicted band size: 62 kDa
-
![Western blot - Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)](https://www.abcam.com/ps/products/181/ab181491/Images/ab181491-210901-anti-cytokeratin-5-antibody-10c11e6-western-blot.jpg)
Western blot - Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)Anti-Cytokeratin 5 antibody [10C11E6] (ab181491) at 1/500 dilution + Human Cytokeratin 5 recombinant protein.
Predicted band size: 62 kDaExpected MWt is 47.8 kDa.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)](https://www.abcam.com/ps/products/181/ab181491/Images/ab181491-210900-anti-cytokeratin-5-antibody-10c11e6-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)Immunohistochemical analysis of paraffin-embedded Human esophagus cancer tissue labeling Cytokeratin 5 with ab181491 at 1/200 dilution, with DAB staining.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)](https://www.abcam.com/ps/products/181/ab181491/Images/ab181491-210899-anti-cytokeratin-5-antibody-10c11e6-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Cytokeratin 5 antibody [10C11E6] (ab181491)Immunohistochemical analysis of paraffin-embedded Human bladder cancer tissue labeling Cytokeratin 5 with ab181491 at 1/200 dilution, with DAB staining.
