Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Energy Metabolism

HRP Anti-Aldolase antibody (ab181662)

HRP Anti-Aldolase antibody (ab181662)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • HRP Goat polyclonal to Aldolase
  • Suitable for: IP, WB
  • Reacts with: Human
  • Conjugation: HRP
  • Isotype: IgG

You may also be interested in

Product image
Human Glycogen Synthase 1 ELISA Kit (ab214031)
Product image
Anti-PKM antibody (ab137791)
Product image
Anti-UAP1 antibody (ab155229)
Product image
Anti-ADK antibody - C-terminal (ab226187)

Overview

  • Product name

    HRP Anti-Aldolase antibody
    See all Aldolase primary antibodies
  • Description

    HRP Goat polyclonal to Aldolase
  • Host species

    Goat
  • Conjugation

    HRP
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length native protein (purified) corresponding to Rabbit Aldolase aa 1-364. Purified from Rabbit Muscle.
    Sequence:

    MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTE NTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKS KGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRC VLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLK RCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKYSHEEIA MATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFIS NHAY


    Database link: P00883
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C.
  • Storage buffer

    Preservative: 0.01% Gentamicin sulphate
    Constituents: 0.88% Sodium chloride, 0.27% Potassium phosphate, 1% BSA
  • Concentration information loading...
  • Purity

    IgG fraction
  • Purification notes

    IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Metabolism of carbohydrates
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Carbohydrate metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Amino acid metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism

Images

  • Western blot - HRP Anti-Aldolase antibody (ab181662)
    Western blot - HRP Anti-Aldolase antibody (ab181662)
    HRP Anti-Aldolase antibody (ab181662) at 1/1000 dilution + A293 whole cell lysate

    Developed using the ECL technique.

    Predicted band size: 39 kDa



    4-12% tris glycine gradient gel for SDS-PAGE

  • Immunoprecipitation - HRP Anti-Aldolase antibody (ab181662)
    Immunoprecipitation - HRP Anti-Aldolase antibody (ab181662)

    Immunoprecipitation and Western Blot analysis.

    300 µl aliquots of whole anti-aldolase antiserum were used to precipitate varying amounts of purified aldolase and precipitates with controls were compared by SDS-PAGE and Western blot. Samples shown in the image are:

    1. Purified aldolase

    2. 300 µl antiserum with no antigen (negative control)

    3. 300 µl antiserum with ~100 µl aldolase (2.5 mg/ml)

    4. 300 µl antiserum with ~200 µl aldolase (2.5 mg/ml)

  • Immunoprecipitation - HRP Anti-Aldolase antibody (ab181662)
    Immunoprecipitation - HRP Anti-Aldolase antibody (ab181662)

    Immunoprecipitation was performed with 300 μl of anti-Aldolase antiserum and an equal volume of varied amounts (diluted from a stock solution of ~2.5 mg/ml) of purified aldolase in PBS. 

    1. Purified Aldolase (1μg)

    2. Precipitation negative control (antiserum + No antigen)

    3. 300 μl antiserum + 20 μl Aldolase

    4. 300 μl antiserum + 80 μl Aldolase

    5. 300 μl antiserum + 120 μl Aldolase

    6. 300 μl antiserum + 150 μl Aldolase

    7. 300 μl antiserum + 300 μl Aldolase

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to HRP Anti-Aldolase antibody (ab181662)

  •  
  • Product image

    HRP Anti-Aldolase + Aldolase B + Aldolase C antibody [EPR9724(B)] (ab200774)

    Applications: WB

  •  
  • Product image

    Anti-Aldolase antibody (ab232786)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Aldolase + Aldolase B + Aldolase C antibody [EPR9724(B)] (ab169544)

    Applications: Flow Cyt, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-Aldolase + Aldolase B + Aldolase C antibody [EPR9724(B)] (ab200771)

    Applications: Flow Cyt, WB

  •  
  • Product image

    Anti-Aldolase antibody [EPR9725] (ab150396)

    Applications: WB

  •  
  • Product image

    Anti-Aldolase + Aldolase B + Aldolase C antibody [EPR9724(B)] - BSA and Azide free (ab231682)

    Applications: Flow Cyt, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-RAMP1 antibody [EPR10867] (ab156575)

  •  
  • Product image

    Anti-4-1BBL antibody [CD137L/1547] (ab223160)

  •  
  • Product image

    Anti-Parainfluenza Virus type 1 nucleocapsid antibody [7F5] (ab34752)

  •  
  • Product image

    PE/Cy5® Anti-CD19 antibody [4G7], prediluted (ab157303)

  •  
  • Product image

    Anti-LOX 1 antibody - BSA and Azide free (Capture) (ab242539)

  •  
  • FITC Anti-alpha 1 Antitrypsin antibody (ab19170)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.