Anti-Tyrosinase antibody (ab180753)
Key features and details
- Rabbit polyclonal to Tyrosinase
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Tyrosinase antibody
See all Tyrosinase primary antibodies -
Description
Rabbit polyclonal to Tyrosinase -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Dog, Gorilla -
Immunogen
Recombinant fragment corresponding to Human Tyrosinase aa 20-340.
Sequence:FPRACVSSKNLMEKECCPPWSGDRSPCGQLSGRGSCQNILLSNAPLGPQF PFTGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFWGPNCTERRLLV RRNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFND INIYDLFVWMHYYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWE QEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFF SSWQIVCSRLEEYNSHQSLCNGTPEGPLRRNPGNHDKSRTPRLPSSADVE FCLSLTQYESGSMDKAANFSF
Database link: P14679 -
Positive control
- WB: Mouse craniofacial and liver tissue lysates; IHC: Rat heart; ICC/ IF: Human skin cancer, rat and mouse skin.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunofluorescence staining of rat skin stained for Tyrosinase with ab180753 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tyrosinase antibody (ab180753)
Paraffin-embedded rat heart tissue stained for Tyrosinase using ab180753 at 1/100 dilution in immunohistochemical analysis.
-
Immunofluorescence staining of human skin cancer stained for Tyrosinase with ab180753 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).
-
All lanes : Anti-Tyrosinase antibody (ab180753) at 1/1000 dilution
Lane 1 : Mouse craniofacial tissue lysate
Lane 2 : Mouse liver tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L)
Predicted band size: 60 kDaBlocking buffer: 3% nonfat dry milk in TBST.
-
Immunofluorescence staining of mouse skin stained for Tyrosinase with ab180753 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).