Recombinant rat G-CSF protein (ab176083)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant rat G-CSF protein
See all G-CSF proteins and peptides -
Biological activity
Determined by its ability to stimulate the proliferation of mouse NFS-60 cells. The expected ED50 is ≤ 0.05 ng/ml, corresponding to a specific activity of ≥ 2 x 107 units/mg.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Rat -
Sequence
MKKIPLLTVSSLPPSLPLPRSFLLKSLEQVRKIQARNTELLEQLCATYKL CHPEELVLFGHSLGIPKASLSSCSSQALQQTKCLSQLHSGLFLYQGLLQA LAGISSELAPTLDMLHLDVDNFATTIWQQMESLGVAPTVQPTQSTMPIFT SAFQRRAGGVLVTSYLQSFLETAHHALHHLPRPAQKHFPESLFISI -
Predicted molecular weight
22 kDa -
Amino acids
22 to 214
Specifications
Our Abpromise guarantee covers the use of ab176083 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.26% Sodium citrate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
General Info
-
Alternative names
- C17orf33
- Colony stimulating factor 3
- Colony stimulating factor 3 (granulocyte)
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Post-translational
modificationsO-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells). -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab176083 has not yet been referenced specifically in any publications.
Preparation and Storage
- C17orf33
- Colony stimulating factor 3
- Colony stimulating factor 3 (granulocyte)