Recombinant mouse G-CSF protein (ab9752)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant mouse G-CSF protein
See all G-CSF proteins and peptides -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCH PEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALS GISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSA FQRRAGGVLAISYLQGFLETARLALHHLA -
Predicted molecular weight
22 kDa -
Amino acids
31 to 208
Associated products
Specifications
Our Abpromise guarantee covers the use of ab9752 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
The ED50, determined by the dose-dependent stimulation of the proliferation of murine NSF-60 cells, is 7 units/mg
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- C17orf33
- Colony stimulating factor 3
- Colony stimulating factor 3 (granulocyte)
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Post-translational
modificationsO-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells). -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab9752 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- C17orf33
- Colony stimulating factor 3
- Colony stimulating factor 3 (granulocyte)
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Post-translational
modificationsO-glycan consists of Gal-GalNAc disaccharide which can be modified with up to two sialic acid residues (done in recombinantly expressed G-CSF from CHO cells). -
Cellular localization
Secreted. - Information by UniProt
