Recombinant mouse PD1 protein (Fc Chimera) (ab216248)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant mouse PD1 protein (Fc Chimera)
See all PD1 proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSN QTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCG AISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ -
Predicted molecular weight
43 kDa including tags -
Amino acids
25 to 167 -
Additional sequence information
Recombinant fragment of mouse PD1 extracellular domain fused to the C-terminal Fc fusion (Mouse IgG2a).
-
Preparation and Storage
-
Alternative names
- CD279
- CD279 antigen
- hPD 1
see all -
Function
Possible cell death inducer, in association with other factors. -
Involvement in disease
Genetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Developmental stage
Induced at programmed cell death. -
Cellular localization
Membrane. - Information by UniProt