Recombinant mouse BTC protein (ab200293)
Key features and details
- Expression system: Escherichia coli
- Purity: > 96% SDS-PAGE
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
-
Product name
Recombinant mouse BTC protein
See all BTC proteins and peptides -
Biological activity
The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 0.01 ng/mL, corresponding to a specific activity of > 1.0 x 108 IU/mg.
-
Purity
> 96 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGR CRFVVDEQTPSCICEKGYFGARCERVDLFY -
Predicted molecular weight
9 kDa -
Amino acids
32 to 111 -
Additional sequence information
This product is for the mature full length protein. A monomeric protein.
-
Preparation and Storage
-
Alternative names
- Betacellulin
- Betacellulin precursor
- BTC
see all -
Function
Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the EGF receptor and other related receptors. -
Tissue specificity
Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine. -
Sequence similarities
Contains 1 EGF-like domain. -
Cellular localization
Cell membrane and Secreted > extracellular space. - Information by UniProt
