Recombinant Human PD-L1 protein (ab112410)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, PepArr, WB
-
Product name
Recombinant Human PD-L1 protein
See all PD-L1 proteins and peptides -
Biological activity
This product is useful for Antibody Production and Protein Array -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKL FNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH -
Predicted molecular weight
37 kDa including tags -
Amino acids
141 to 240 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- B7 H
- B7 H1
- B7 homolog 1
see all -
Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. -
Tissue specificity
Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane and Endomembrane system. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human PD-L1 protein (ab112410)12.5% SDS-PAGE image, using ab112410. (Stained with Coomassie Blue).
