Recombinant human CT-1 protein (ab134868)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human CT-1 protein
See all CT-1 proteins and peptides -
Biological activity
Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml. -
Purity
> 95 % SDS-PAGE.
ab134868 was constructed as a fusion protein and was highly purified using affinity matrix from E. coli. After specific proteinase cleavage, native CT-1 protein was collected and suspended in PBS buffer. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQL QGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLL DAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA -
Predicted molecular weight
21 kDa -
Amino acids
2 to 201
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab134868 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Liquid -
Additional notes
Previously labelled as Cardiotrophin 1.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Cardiophin 1
- Cardiophin1
- Cardiotrophin I
see all -
Function
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor. -
Tissue specificity
Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab134868 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Constituent: 99% PBS
This product is an active protein and may elicit a biological response in vivo, handle with caution.