Recombinant Human CT-1 protein (Tagged-His Tag) (ab192279)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human CT-1 protein (Tagged-His Tag)
See all CT-1 proteins and peptides -
Purity
> 95 % SDS-PAGE.
The purity of ab192279 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MNHKVHHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTK YAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRL DAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEAL LAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTE GDLGQLLPGGSA -
Predicted molecular weight
23 kDa including tags -
Amino acids
1 to 201 -
Tags
His tag N-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab192279 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
Previously labelled as Cardiotrophin 1.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
0.2 µM filtered solution. -
ReconstitutionDissolve protein in 1 x PBS to a concentration no less than 100ug/ml
General Info
-
Alternative names
- Cardiophin 1
- Cardiophin1
- Cardiotrophin I
see all -
Function
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor. -
Tissue specificity
Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab192279 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
0.2 µM filtered solution. -
ReconstitutionDissolve protein in 1 x PBS to a concentration no less than 100ug/ml