Recombinant rat CT-1 protein (Active) (ab243215)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Active: Yes
- Suitable for: HPLC, SDS-PAGE, Functional Studies
-
Product name
Recombinant rat CT-1 protein (Active)
See all CT-1 proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of >2.0x106 IU/mg.
-
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Rat -
Sequence
MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQ QQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPAL LDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGP VPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPG GVA -
Predicted molecular weight
21 kDa -
Amino acids
1 to 203
Specifications
Our Abpromise guarantee covers the use of ab243215 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
HPLC
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.33% Phosphate Buffer, 0.87% Sodium chloride
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionBriefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20 °C or below. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- Cardiophin 1
- Cardiophin1
- Cardiotrophin I
see all -
Function
Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor. -
Tissue specificity
Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes. -
Sequence similarities
Belongs to the IL-6 superfamily. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243215 has not yet been referenced specifically in any publications.
Preparation and Storage
- Cardiophin 1
- Cardiophin1
- Cardiotrophin I