Recombinant German cockroach Allergen Bla g 4 protein (His tag) (ab225565)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant German cockroach Allergen Bla g 4 protein (His tag) -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
German cockroach -
Sequence
NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALV SKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENY AIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKA IEEDLKHFNLKYEDLHSTCH -
Predicted molecular weight
36 kDa including tags -
Amino acids
13 to 182 -
Tags
His tag N-Terminus -
Additional sequence information
This product is the mature full length protein from aa 13 to 182 with 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
Images
-
SDS-PAGE - Recombinant German cockroach Allergen Bla g 4 protein (His tag) (ab225565)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225565 with 5% enrichment gel and 15% separation gel.
-
Mass Spectrometry - Recombinant German cockroach Allergen Bla g 4 protein (His tag) (ab225565)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225565 could indicate that this peptide derived from E.coli-expressed German cockroach Allergen Bla g 4 protein.
-
Mass Spectrometry - Recombinant German cockroach Allergen Bla g 4 protein (His tag) (ab225565)Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225565 could indicate that this peptide derived from E.coli-expressed German cockroach Allergen Bla g 4 protein.
