Anti-SOX10 antibody [2E7B5] (ab181466)
Key features and details
- Mouse monoclonal [2E7B5] to SOX10
- Suitable for: WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-SOX10 antibody [2E7B5]
See all SOX10 primary antibodies -
Description
Mouse monoclonal [2E7B5] to SOX10 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Mouse, Rat, Chicken, Pig -
Immunogen
Recombinant fragment corresponding to Human SOX10 aa 147-252. (Expressed in E.coli).
Sequence:ESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAE QGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPK TELQSG
Database link: P56693 -
Positive control
- SOX10 recombinant protein; SOX10 (Amino acid: 147-252)-hIgGFc transfected HEK293 cell lysate; HepG2 cells.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR243375-14 are from Tissue Culture Supernatant
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
2E7B5 -
Isotype
IgG1 -
Research areas
Images
-
Flow cytometric analysis of HepG2 cells labeling SOX10 with ab181466 at 1/200 dilution (green) compared to a negative control (red).
-
All lanes : Anti-SOX10 antibody [2E7B5] (ab181466) at 1/500 dilution
Lane 1 : HEK293 cell lysate.
Lane 2 : SOX10 (Amino acids: 147-252)-hIgGFc transfected HEK293 cell lysate.
Predicted band size: 49 kDa
-
Anti-SOX10 antibody [2E7B5] (ab181466) at 1/500 dilution + SOX10 recombinant protein
Predicted band size: 49 kDaExpected MWt is 31.7 kDa.