Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Cell Type Marker Neural Stem Cell marker

Anti-SOX10 antibody [2E7B5] (ab181466)

Anti-SOX10 antibody [2E7B5] (ab181466)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [2E7B5] to SOX10
  • Suitable for: WB, Flow Cyt
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Human MSX1 knockout A549 cell lysate (ab258526)
Product image
Recombinant Human CD24 protein (ab158052)
Product image
Anti-PAX6 antibody [AD2.35] (ab245110)
Product image
Anti-Pax2 antibody [EP3251] - BSA and Azide free (ab215974)

Overview

  • Product name

    Anti-SOX10 antibody [2E7B5]
    See all SOX10 primary antibodies
  • Description

    Mouse monoclonal [2E7B5] to SOX10
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
    Predicted to work with: Mouse, Rat, Chicken, Pig
  • Immunogen

    Recombinant fragment corresponding to Human SOX10 aa 147-252. (Expressed in E.coli).
    Sequence:

    ESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAE QGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPK TELQSG


    Database link: P56693
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • SOX10 recombinant protein; SOX10 (Amino acid: 147-252)-hIgGFc transfected HEK293 cell lysate; HepG2 cells.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR243375-14 are from Tissue Culture Supernatant

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer.
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    2E7B5
  • Isotype

    IgG1
  • Research areas

    • Neuroscience
    • Cell Type Marker
    • Neural Stem Cell marker
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • HMG Box
    • Stem Cells
    • Lineage Markers
    • Ectoderm
    • Developmental Biology
    • Lineage specification
    • Ectoderm

Images

  • Flow Cytometry - Anti-SOX10 antibody [2E7B5] (ab181466)
    Flow Cytometry - Anti-SOX10 antibody [2E7B5] (ab181466)

    Flow cytometric analysis of HepG2 cells labeling SOX10 with ab181466 at 1/200 dilution (green) compared to a negative control (red).

  • Western blot - Anti-SOX10 antibody [2E7B5] (ab181466)
    Western blot - Anti-SOX10 antibody [2E7B5] (ab181466)
    All lanes : Anti-SOX10 antibody [2E7B5] (ab181466) at 1/500 dilution

    Lane 1 : HEK293 cell lysate.
    Lane 2 : SOX10 (Amino acids: 147-252)-hIgGFc transfected HEK293 cell lysate.

    Predicted band size: 49 kDa

  • Western blot - Anti-SOX10 antibody [2E7B5] (ab181466)
    Western blot - Anti-SOX10 antibody [2E7B5] (ab181466)
    Anti-SOX10 antibody [2E7B5] (ab181466) at 1/500 dilution + SOX10 recombinant protein

    Predicted band size: 49 kDa



    Expected MWt is 31.7 kDa.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-SOX10 antibody [2E7B5] (ab181466)

  •  
  • Product image

    Anti-SOX10 antibody [EPR4007] - BSA and Azide free (ab186821)

    Applications: Flow Cyt, ICC/IF, IHC-FoFr, WB

  •  
  • Product image

    Anti-SOX10 antibody [SP267] - BSA and Azide free (ab245760)

    Applications: Flow Cyt, ICC/IF, IHC-FoFr, IHC-P, WB

  •  
  • Product image

    Anti-SOX10 antibody [EPR4007-104] - BSA and Azide free (ab220078)

    Applications: IHC-FoFr, IHC-P

  •  
  • Product image

    Anti-SOX10 antibody [SP267] (ab227680)

    Applications: Flow Cyt, ICC/IF, IHC-FoFr, IHC-P, WB

  •  
  • Product image

    Anti-SOX10 antibody [EPR4007] (ab155279)

    Applications: Flow Cyt, ICC/IF, IHC-FoFr, WB

  •  
  • Product image

    Anti-SOX10 antibody [SP275] - BSA and Azide free (ab239751)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-SOX10 antibody [EPR4007-104] (ab180862)

    Applications: IHC-FoFr, IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-PABPN1 antibody [EP3000Y] (ab75855)

  •  
  • Product image

    Anti-COX2 / Cyclooxygenase 2 antibody (ab15191)

  •  
  • Product image

    Anti-Prothrombin antibody [EPR20131] (ab208590)

  •  
  • Product image

    Anti-Cyclophilin A antibody (ab41684)

  •  
  • Product image

    Anti-Cdk5 antibody - C-terminal (ab151233)

  •  
  • Product image

    Anti-CD300e antibody [UP-H2] (ab188410)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.