Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
Key features and details
- Rabbit polyclonal to Occludin - Neural Stem Cell Marker
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Occludin antibody - Neural Stem Cell Marker
See all Occludin primary antibodies -
Description
Rabbit polyclonal to Occludin - Neural Stem Cell Marker -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Dog, Orangutan
-
Immunogen
Recombinant full length protein corresponding to Human Occludin aa 1-522.
Sequence:MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED EILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGG SVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFI AALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPT AQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLG FMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYET DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL DEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHC KQLKSKLSHIKKMVGDYDRQKT
Database link: NP_002529.1 -
Positive control
- Human and Mouse liver lysates; Occludin-transfected 293T cell line lysate This antibody gave a positive result in IHC in the following FFPE tissue: Human normal kidney
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml + Human liver lysate at 50 µg
Secondary
Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution
Developed using the ECL technique.
Predicted band size: 59 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)IHC image of Occludin staining in Human normal kidney formalin fixed paraffin embedded tissue section*, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab168986, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.
For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
*Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre
-
Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml + Mouse liver lysate at 50 µg
Secondary
Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution
Developed using the ECL technique.
Predicted band size: 59 kDa
-
All lanes : Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml
Lane 1 : Occludin-transfected 293T cell line lysate
Lane 2 : Non-transfected 293T cell line lysate
Secondary
All lanes : Goat Anti-Rabbit IgG at 1/7500 dilution
Developed using the ECL technique.
Predicted band size: 59 kDa

