Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cell Adhesion Tight Junctions

Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)

Price and availability

314 937 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Occludin - Neural Stem Cell Marker
  • Suitable for: WB, IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-TJP2/ZO2 antibody (ab224314)
Product image
Anti-Claudin 3 antibody [EPR19971] (ab214487)
Product image
Anti-BVES antibody - C-terminal (ab196551)
Product image
Anti-Claudin 7/CLDN-7 antibody [EPR18073] (ab207300)

Overview

  • Product name

    Anti-Occludin antibody - Neural Stem Cell Marker
    See all Occludin primary antibodies
  • Description

    Rabbit polyclonal to Occludin - Neural Stem Cell Marker
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Dog, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Occludin aa 1-522.
    Sequence:

    MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED EILHFYKWTSPPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGG SVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGFMLAMAAFCFI AALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPT AQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLG FMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYET DYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL DEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHC KQLKSKLSHIKKMVGDYDRQKT


    Database link: NP_002529.1
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human and Mouse liver lysates; Occludin-transfected 293T cell line lysate This antibody gave a positive result in IHC in the following FFPE tissue: Human normal kidney
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cell Adhesion
    • Tight Junctions

Images

  • Western blot - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
    Western blot - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
    Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml + Human liver lysate at 50 µg

    Secondary
    Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 59 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)

    IHC image of Occludin staining in Human normal kidney formalin fixed paraffin embedded tissue section*, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab168986, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    *Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre

  • Western blot - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
    Western blot - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
    Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml + Mouse liver lysate at 50 µg

    Secondary
    Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 59 kDa

  • Western blot - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
    Western blot - Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)
    All lanes : Anti-Occludin antibody - Neural Stem Cell Marker (ab168986) at 1 µg/ml

    Lane 1 : Occludin-transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Secondary
    All lanes : Goat Anti-Rabbit IgG at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 59 kDa

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Occludin antibody - Neural Stem Cell Marker (ab168986)

  •  
  • Product image

    Anti-Occludin antibody [CL1555] (ab242202)

    Applications: ICC, IHC-P, WB

  •  
  • Product image

    Anti-Occludin antibody [EPR20992] - BSA and Azide free (ab224526)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Occludin antibody [EPR20992] (ab216327)

    Applications: Flow Cyt, ICC/IF, IHC-P, IP, WB

  •  
  • Product image

    Anti-Occludin antibody [EPR8208] (ab167161)

    Applications: WB

  •  
  • Product image

    Anti-Occludin antibody [EPR8208] - BSA and Azide free (ab240150)

    Applications: WB

  •  
  • Product image

    Anti-Occludin antibody (ab235986)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Occludin antibody (ab31721)

    Applications: WB

  •  
  • Product image

    Anti-Occludin antibody (ab222691)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-DPP6 antibody [EPR15944-24] (ab198506)

  •  
  • Product image

    Anti-Hsp27 (phospho S78) antibody [Y175] (ab32501)

  •  
  • Goat Anti-Rat IgG H&L (Cy3 ®) preadsorbed (ab6953)

  •  
  • Product image

    Anti-EGFR (phospho Y1173) antibody - C-terminal (ab226889)

  •  
  • Product image

    Recombinant Human Kallikrein 13 protein (denatured) (ab202250)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.