Anti-IMP3 antibody (ab176685)
Key features and details
- Rabbit polyclonal to IMP3
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-IMP3 antibody
See all IMP3 primary antibodies -
Description
Rabbit polyclonal to IMP3 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human IMP3 aa 1-50. The exact sequence is proprietary.
Sequence:MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWA
Database link: O00425 -
Positive control
- HeLa, Jurkat and 293T whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituent: 0.1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176685 was affinity purified using an epitope specific to IMP3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-IMP3 antibody (ab176685) at 0.04 µg/ml
Lane 1 : HeLa lysate at 50 µg
Lane 2 : HeLa lysate at 15 µg
Lane 3 : Jurkat lysate at 50 µg
Lane 4 : 293T lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 64 kDa
Exposure time: 3 minutes
-
Detection of Human IMP3 by Western Blot of Immunoprecipitates.
Detection of IMP3 in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab176685 at 6 µg/mg lysate for IP. For WB analysis of immunoprecipitated IMP3, ab176685 was used at 1 µg/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.

