Anti-IDH2 antibody (ab55271)
Key features and details
- Mouse monoclonal to IDH2
- Suitable for: IHC-P, Flow Cyt, ICC/IF, WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-IDH2 antibody
See all IDH2 primary antibodies -
Description
Mouse monoclonal to IDH2 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB HumanRecombinant fragment -
Immunogen
Recombinant fragment corresponding to Human IDH2 aa 354-451.
Sequence:HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCV ETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
Database link: P48735 -
Positive control
- IHC-P: Human colon. Flow cyt: MCF7 cells. WB: Transfected 293T cells.
-
General notes
This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4 -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Images
-
Western blot against tagged recombinant protein immunogen using ab55271 IDH2 antibody at 1ug/ml. Predicted band size of immunogen is 37 kDa
This image was generated using the ascites version of the product.
-
IDH2 antibody (ab55271) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human colon.
This image was generated using the ascites version of the product.
-
ICC/IF image of ab55271 stained Mcf7 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55271, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
All lanes : Anti-IDH2 antibody (ab55271)
Lane 1 : IDH2 in transfected 293T cell line
Lane 2 : Non-transfected lysateThe blocking agent used is 5% milk.
This image was generated using the ascites version of the product.
-
Overlay histogram showing MCF7 cells stained with ab55271 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab55271, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in MCF7 cells fixed with 80% methanol (5 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
This image was generated using the ascites version of the product.

