Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Metabolism Energy Metabolism

Anti-IDH2 antibody (ab55271)

Price and availability

381 945 ₸

Availability

Order now and get it on Wednesday March 10, 2021

Anti-IDH2 antibody (ab55271)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to IDH2
  • Suitable for: IHC-P, Flow Cyt, ICC/IF, WB
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Recombinant Human Lactate Dehydrogenase protein (Tagged) (ab275936)
Product image
Anti-TORC2 antibody [EPR20219] (ab184239)
Product image
Anti-IDH2 (mutated R172W) antibody [WMab-1] (ab264054)
Product image
Anti-GLB1/Beta-galactosidase antibody (ab220283)

Overview

  • Product name

    Anti-IDH2 antibody
    See all IDH2 primary antibodies
  • Description

    Mouse monoclonal to IDH2
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Human
    IHC-P
    Human
    WB
    Human
    Recombinant fragment
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human IDH2 aa 354-451.
    Sequence:

    HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCV ETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR


    Database link: P48735
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human colon. Flow cyt: MCF7 cells. WB: Transfected 293T cells.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 13th Feb 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Metabolism
    • Energy Metabolism
    • Signal Transduction
    • Metabolism
    • Mitochondrial
    • Cancer
    • Cancer Metabolism
    • Metabolic signaling pathway
    • Integration of energy metabolism
    • Metabolism
    • Pathways and Processes
    • Mitochondrial Metabolism
    • Mitochondrial markers
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Energy Metabolism
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Energy transfer pathways
    • Integration of energy
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-IDH2 antibody (ab55271)
    Western blot - Anti-IDH2 antibody (ab55271)

    Western blot against tagged recombinant protein immunogen using ab55271 IDH2 antibody at 1ug/ml. Predicted band size of immunogen is 37 kDa

    This image was generated using the ascites version of the product.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH2 antibody (ab55271)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-IDH2 antibody (ab55271)

    IDH2 antibody (ab55271) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human colon.

    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-IDH2 antibody (ab55271)
    Immunocytochemistry/ Immunofluorescence - Anti-IDH2 antibody (ab55271)

    ICC/IF image of ab55271 stained Mcf7 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab55271, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-IDH2 antibody (ab55271)
    Western blot - Anti-IDH2 antibody (ab55271)
    All lanes : Anti-IDH2 antibody (ab55271)

    Lane 1 : IDH2 in transfected 293T cell line
    Lane 2 : Non-transfected lysate


    The blocking agent used is 5% milk.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-IDH2 antibody (ab55271)
    Flow Cytometry - Anti-IDH2 antibody (ab55271)

    Overlay histogram showing MCF7 cells stained with ab55271 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab55271, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in MCF7 cells fixed with 80% methanol (5 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-IDH2 antibody (ab55271)

  •  
  • Product image

    Anti-IDH2 antibody [EPR7577] - BSA and Azide free (ab230796)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-IDH2 antibody [EPR7577] (ab131263)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    PE Anti-IDH2 antibody [EPR7577] (ab212122)

    Applications: Flow Cyt

  •  
  • Product image

    Anti-IDH2 antibody [EPR7576] (ab129180)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-IDH2 antibody [EPR7576] - BSA and Azide free (ab246343)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-IDH2 antibody (ab94359)

    Applications: ICC/IF, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-TORC1 antibody (ab264144)

  •  
  • Product image

    Anti-CBAP antibody (ab121813)

  •  
  • Product image

    Anti-ZNF331 antibody (ab67886)

  •  
  • Product image

    Anti-MAD2 antibody (ab70385)

  •  
  • Product image

    Anti-PEDF antibody (ab180711)

  •  
  • Product image

    Anti-TYK2 antibody (ab39550)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.