Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Neurotransmitter Transporters Glutamate

Anti-Glutamine Synthetase antibody (ab64613)

Price and availability

381 945 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-Glutamine Synthetase antibody (ab64613)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to Glutamine Synthetase
  • Suitable for: WB, Flow Cyt, Sandwich ELISA, IHC-P, ICC/IF
  • Reacts with: Mouse, Rat, Human, Drosophila melanogaster, Zebrafish, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Human EAAT1 peptide (ab42682)
(R,S)-AMPA (mM/ml), AMPA agonist (ab146679)
Riluzole (PK 26124), GABA uptake inhibitor (ab120272)
Product image
7-Chlorokynurenic acid, NMDA receptor glycine site antagonist (ab120024)

Overview

  • Product name

    Anti-Glutamine Synthetase antibody
    See all Glutamine Synthetase primary antibodies
  • Description

    Mouse monoclonal to Glutamine Synthetase
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    Rat
    IHC-P
    Human
    sELISA
    Recombinant fragment
    WB
    Mouse
    Rat
    Human
    Zebrafish
    See all applications and species data
  • Immunogen

    Recombinant fragment corresponding to Human Glutamine Synthetase aa 274-373.
    Sequence:

    IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASI RIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN


    Database link: P15104
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-P: Human tonsil tissue. WB: Jurkat whole cell lysate; Raw 264.7 cells, HepG2 cell, PC-12, Zebrafish brain, liver, skeletal muscle homogenate ICC: PC12 cells. Flow Cyt: Jurkat cells.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 22/03/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Clonality

    Monoclonal
  • Isotype

    IgG1
  • Research areas

    • Neuroscience
    • Neurotransmitter
    • Amino Acids
    • Glutamate
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Alzheimer's disease
    • Other

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamine Synthetase antibody (ab64613)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamine Synthetase antibody (ab64613)

    IHC image of ab64613 staining in human tonsil formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab64613, 1µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Anti-Glutamine Synthetase antibody (ab64613) at 1 µg/ml + Jurkat cell lysate at 50 µg

    Secondary
    Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution

    Predicted band size: 42 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?



    This image was generated using the ascites version of the product.

  • Immunocytochemistry/ Immunofluorescence - Anti-Glutamine Synthetase antibody (ab64613)
    Immunocytochemistry/ Immunofluorescence - Anti-Glutamine Synthetase antibody (ab64613)

    ICC/IF image of ab64613 stained PC12 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab64613, 5µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    This image was generated using the ascites version of the product.

  • Flow Cytometry - Anti-Glutamine Synthetase antibody (ab64613)
    Flow Cytometry - Anti-Glutamine Synthetase antibody (ab64613)

    Overlay histogram showing Jurkat cells stained with ab64613 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab64613, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in Jurkat cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    All lanes : Anti-Glutamine Synthetase antibody (ab64613)

    Lane 1 : Glutamine Synthetase transfected lysate
    Lane 2 : Non-transfected lysate

    Predicted band size: 42 kDa



    This image was generated using the ascites version of the product.

  • Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Anti-Glutamine Synthetase antibody (ab64613) + Raw 264.7 cell line

    Predicted band size: 42 kDa



    This image was generated using the ascites version of the product.

  • Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Anti-Glutamine Synthetase antibody (ab64613) + HepG2 cell lysate

    Predicted band size: 42 kDa



    This image was generated using the ascites version of the product.

  • Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Anti-Glutamine Synthetase antibody (ab64613) + PC-12 cell lysate

    Predicted band size: 42 kDa



    This image was generated using the ascites version of the product.

  • Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    Western blot - Anti-Glutamine Synthetase antibody (ab64613)
    All lanes : Anti-Glutamine Synthetase antibody (ab64613) at 0.5 µg/ml

    Lane 1 : Marker
    Lane 2 : Zebrafish brain homogenate at 20 µg
    Lane 3 : Zebrafish liver homogenate at 20 µg
    Lane 4 : Zebrafish skeletal muscle homogenate at 20 µg
    Lane 5 : JURKAT (Human T cell lymphoblast-like cell line) whole cell lysate at 20 µg

    Secondary
    All lanes : Goat polyclonal to Mouse IgG – H&L – Pre-Adsorbed (HRP) at 1/6000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 42 kDa
    Observed band size: 42 kDa


    Exposure time: 4 minutes


    This image was generated using the ascites version of the product.

  • Sandwich ELISA - Anti-Glutamine Synthetase antibody (ab64613)
    Sandwich ELISA - Anti-Glutamine Synthetase antibody (ab64613)

    Detection limit for recombinant GST tagged Glutamine Synthetase is approximately 0.03ng/ml as a capture antibody.

    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Glutamine Synthetase antibody (ab64613)

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab49873)

    Applications: WB

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab16802)

    Applications: ICC/IF, In-Cell ELISA, WB

  •  
  • Product image

    Anti-Glutamine Synthetase antibody [EPR13022(B)] - BSA and Azide free (ab240193)

    Applications: IHC-Fr, IHC-P, WB

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab228590)

    Applications: ICC/IF, IHC-Fr, IHC-P, IP, WB

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab264395)

    Applications: IP

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab73593)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab210107)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab181625)

    Applications: WB

  •  
  • Product image

    HRP Anti-Glutamine Synthetase antibody [EPR13022(B)] (ab199198)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-NDUFB7 antibody [EPR15903] (ab188575)

  •  
  • Product image

    Anti-ID4 antibody [EPR22323-36] (ab220166)

  •  
  • Product image

    Anti-ACADM/MCAD antibody [EPR3707] (ab108192)

  •  
  • Product image

    Total OXPHOS Rodent WB Antibody Cocktail (ab110413)

  •  
  • Product image

    Anti-Smac/Diablo antibody [8H5AA3] (ab110288)

  •  
  • Product image

    Anti-CD52 antibody [YTH 34.5-G2b (Campath-1G)] (ab245701)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.