Anti-Glutamine Synthetase antibody (ab64613)
Key features and details
- Mouse monoclonal to Glutamine Synthetase
- Suitable for: WB, Flow Cyt, Sandwich ELISA, IHC-P, ICC/IF
- Reacts with: Mouse, Rat, Human, Drosophila melanogaster, Zebrafish, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-Glutamine Synthetase antibody
See all Glutamine Synthetase primary antibodies -
Description
Mouse monoclonal to Glutamine Synthetase -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF RatIHC-P HumansELISA Recombinant fragmentWB MouseRatHumanZebrafish
-
Immunogen
Recombinant fragment corresponding to Human Glutamine Synthetase aa 274-373.
Sequence:IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASI RIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Database link: P15104 -
Positive control
- IHC-P: Human tonsil tissue. WB: Jurkat whole cell lysate; Raw 264.7 cells, HepG2 cell, PC-12, Zebrafish brain, liver, skeletal muscle homogenate ICC: PC12 cells. Flow Cyt: Jurkat cells.
-
General notes
This product was changed from ascites to tissue culture supernatant on 22/03/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4
Constituent: PBS -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Glutamine Synthetase antibody (ab64613)
IHC image of ab64613 staining in human tonsil formalin fixed paraffin embedded tissue section, performed on a Leica BondTM system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab64613, 1µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.
For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.This image was generated using the ascites version of the product.
-
Western blot - Anti-Glutamine Synthetase antibody (ab64613)Anti-Glutamine Synthetase antibody (ab64613) at 1 µg/ml + Jurkat cell lysate at 50 µg
Secondary
Goat Anti-Mouse IgG (H&L)-HRP at 1/2500 dilution
Predicted band size: 42 kDa
Observed band size: 37 kDa why is the actual band size different from the predicted?This image was generated using the ascites version of the product.
-
Immunocytochemistry/ Immunofluorescence - Anti-Glutamine Synthetase antibody (ab64613)ICC/IF image of ab64613 stained PC12 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab64613, 5µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.
This image was generated using the ascites version of the product.
-
Flow Cytometry - Anti-Glutamine Synthetase antibody (ab64613)Overlay histogram showing Jurkat cells stained with ab64613 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab64613, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in Jurkat cells fixed with 4% paraformaldehyde (10 min)/permeabilized with 0.1% PBS-Tween for 20 min used under the same conditions.
This image was generated using the ascites version of the product.
-
Western blot - Anti-Glutamine Synthetase antibody (ab64613)All lanes : Anti-Glutamine Synthetase antibody (ab64613)
Lane 1 : Glutamine Synthetase transfected lysate
Lane 2 : Non-transfected lysate
Predicted band size: 42 kDaThis image was generated using the ascites version of the product.
-
Western blot - Anti-Glutamine Synthetase antibody (ab64613)Anti-Glutamine Synthetase antibody (ab64613) + Raw 264.7 cell line
Predicted band size: 42 kDaThis image was generated using the ascites version of the product.
-
Western blot - Anti-Glutamine Synthetase antibody (ab64613)Anti-Glutamine Synthetase antibody (ab64613) + HepG2 cell lysate
Predicted band size: 42 kDaThis image was generated using the ascites version of the product.
-
Western blot - Anti-Glutamine Synthetase antibody (ab64613)Anti-Glutamine Synthetase antibody (ab64613) + PC-12 cell lysate
Predicted band size: 42 kDaThis image was generated using the ascites version of the product.
-
Western blot - Anti-Glutamine Synthetase antibody (ab64613)All lanes : Anti-Glutamine Synthetase antibody (ab64613) at 0.5 µg/ml
Lane 1 : Marker
Lane 2 : Zebrafish brain homogenate at 20 µg
Lane 3 : Zebrafish liver homogenate at 20 µg
Lane 4 : Zebrafish skeletal muscle homogenate at 20 µg
Lane 5 : JURKAT (Human T cell lymphoblast-like cell line) whole cell lysate at 20 µg
Secondary
All lanes : Goat polyclonal to Mouse IgG – H&L – Pre-Adsorbed (HRP) at 1/6000 dilution
Developed using the ECL technique.
Performed under reducing conditions.
Predicted band size: 42 kDa
Observed band size: 42 kDa
Exposure time: 4 minutesThis image was generated using the ascites version of the product.
-
Sandwich ELISA - Anti-Glutamine Synthetase antibody (ab64613)Detection limit for recombinant GST tagged Glutamine Synthetase is approximately 0.03ng/ml as a capture antibody.
This image was generated using the ascites version of the product.
