Anti-GLP1 antibody [11E2] (ab23468)
Key features and details
- Mouse monoclonal [11E2] to GLP1
- Suitable for: ICC/IF
- Reacts with: Rat
- Isotype: IgG2a
Overview
-
Product name
Anti-GLP1 antibody [11E2]
See all GLP1 primary antibodies -
Description
Mouse monoclonal [11E2] to GLP1 -
Host species
Mouse -
Specificity
This antibody reacts with all forms of GLP 1, including precursor. -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Guinea pig, Cow
-
Immunogen
Synthetic peptide corresponding to Human GLP1 aa 98-127. The immunogen sequence corresponds to Glucagon-like peptide 1(7-36), one of the chains formed when cleaved. Immunogen was coupled to a carrier and adsorbed onto aluminum hydroxide gel.
Sequence:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Database link: P01275 -
Epitope
This antibody reacts with a mid-molecular epitope of GLP 1 (Glucagon-like peptide 1(7-36)). -
Positive control
- ICC/IF: PC12 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.097% Sodium azide
Constituents: 0.0268% PBS, 2.9% Sodium chloride -
Concentration information loading... -
Purification notes
Protein A/G purified -
Clonality
Monoclonal -
Clone number
11E2 -
Myeloma
x63-Ag8.653 -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
ICC/IF image of ab23468 stained PC12 cells. The cells were 4% formaldehyde (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab23468, 10µg/ml) overnight at +4°C. The secondary antibody (green) was ab96879 Dylight 488 goat anti-mouse IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

