Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling GPCR

Anti-Endothelin A Receptor/ET-A antibody (ab76259)

Price and availability

301 536 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-Endothelin A Receptor/ET-A antibody (ab76259)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Endothelin A Receptor/ET-A
  • Suitable for: WB, ICC/IF, IHC-P
  • Reacts with: Human, African green monkey
  • Isotype: IgG

You may also be interested in

Product image
Anti-GPCR GPR48/LGR4 antibody [6G8.B3.G5.C3] (ab106089)
Product image
Anti-SSTR4 antibody (ab28578)
Anti-EDG8 antibody (ab167049)
Product image
Anti-EDG3/S1P3 antibody [EPR4541(2)] - BSA and Azide free (ab248131)

Overview

  • Product name

    Anti-Endothelin A Receptor/ET-A antibody
    See all Endothelin A Receptor/ET-A primary antibodies
  • Description

    Rabbit polyclonal to Endothelin A Receptor/ET-A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, African green monkey
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Endothelin A Receptor/ET-A aa 378-427 (C terminal). The exact sequence is proprietary. (NP_001948.1).
    Sequence:

    NCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN


    Database link: P25101
    (Peptide available as ab154991)
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 0.87% Sodium chloride, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Signaling Pathway
    • G Protein Signaling
    • GPCR
    • Signal Transduction
    • Growth Factors/Hormones
    • Hormones
    • Cancer
    • Cancer Metabolism
    • Response to hypoxia
    • Metabolism
    • Pathways and Processes
    • Metabolism processes
    • Hypoxia
    • Metabolism
    • Types of disease
    • Cancer

Images

  • Western blot - Anti-Endothelin A Receptor/ET-A antibody (ab76259)
    Western blot - Anti-Endothelin A Receptor/ET-A antibody (ab76259)
    All lanes : Anti-Endothelin A Receptor/ET-A antibody (ab76259) at 1/500 dilution

    Lane 1 : Extracts from COS-7 cells
    Lane 2 : Extracts from COS-7 cells plus 5µg immunizing peptide

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 49 kDa
    Observed band size: 49 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-Endothelin A Receptor/ET-A antibody (ab76259)
    Immunocytochemistry/ Immunofluorescence - Anti-Endothelin A Receptor/ET-A antibody (ab76259)
    Immunofluorescence analysis of LOVO cells using ab76259 at a 1/500 dilution.
    Left image un-treated.
    Right image treated with immunizing peptide.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Endothelin A Receptor/ET-A antibody (ab76259)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Endothelin A Receptor/ET-A antibody (ab76259)

    ab76259 (4µg/ml) staining Endothelin A/ET-A receptor in human cerebellum using an automated system (DAKO Autostainer Plus). Using this protocol there is strong staining of the endothelium.
    Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer EDTA pH 9.0 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Endothelin A Receptor/ET-A antibody (ab76259)

  •  
  • Product image

    Anti-Endothelin A Receptor/ET-A antibody [UMB-8-37-1] - BSA and Azide free (ab242440)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Endothelin A Receptor/ET-A antibody (ab117521)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Endothelin A Receptor/ET-A antibody - Extracellular domain (ab219358)

    Applications: IHC-P

  •  
  • Product image

    Anti-Endothelin A Receptor/ET-A antibody (ab85163)

    Applications: WB

  •  
  • Product image

    Anti-Endothelin A Receptor/ET-A antibody [UMB-8-37-1] (ab178454)

    Applications: IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Sbf1 antibody [EPR12566] (ab177146)

  •  
  • Product image

    Anti-Transferrin antibody [1F10] (ab218020)

  •  
  • Product image

    Anti-Monoacylglycerol Lipase/MGL antibody (ab246902)

  •  
  • Product image

    Anti-Endothelin A Receptor/ET-A antibody (ab85163)

  •  
  • Product image

    Anti-UGT1A9 antibody (ab180707)

  •  
  • Product image

    Anti-Cdc20 antibody (ab155921)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.