Anti-DIS3 antibody (ab176802)
Key features and details
- Rabbit polyclonal to DIS3
- Suitable for: IP, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-DIS3 antibody
See all DIS3 primary antibodies -
Description
Rabbit polyclonal to DIS3 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human DIS3 aa 908-958. The exact sequence is proprietary. (NP_055768.3).
Sequence:KVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKLG K
Database link: Q9Y2L1 -
Positive control
- HeLa, 293T and Jurkat whole cell lysates.
-
General notes
This product was previously labelled as DIS3, Dis3
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176802 was affinity purified using an epitope specific to DIS3 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-DIS3 antibody (ab176802)All lanes : Anti-DIS3 antibody (ab176802) at 0.1 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : 293T whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 109 kDa
Exposure time: 30 seconds
-
Immunoprecipitation - Anti-DIS3 antibody (ab176802)Detection of DIS3 in immunoprecipitates of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176802 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 10 seconds.
