Anti-CSDE1/NRU antibody (ab176584)
Key features and details
- Rabbit polyclonal to CSDE1/NRU
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CSDE1/NRU antibody
See all CSDE1/NRU primary antibodies -
Description
Rabbit polyclonal to CSDE1/NRU -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human -
Immunogen
Synthetic peptide within Human CSDE1/NRU aa 50-100. The exact sequence is proprietary. (NP_001007554.1).
Sequence:FFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEER M
Database link: O75534 -
Positive control
- HeLa and 293T whole cell lysates.
-
General notes
This product was previously labelled as CSDE1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab176584 was affinity purified using an epitope specific to CSDE1/NRU immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Detection of CSDE1/NRU by Western Blot of Immunprecipitate.
ab176584 at 0.4µg/ml labeling CSDE1/NRU in HeLa whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176584 at 6µg/mg lysate.Detection: Chemiluminescence with exposure time of 10 seconds.
-
All lanes : Anti-CSDE1/NRU antibody (ab176584) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 89 kDa
Exposure time: 10 seconds

