Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Developmental Biology Lineage specification Ectoderm

Anti-Cripto1/CRIPTO antibody (ab178560)

Anti-Cripto1/CRIPTO antibody (ab178560)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Cripto1/CRIPTO
  • Suitable for: WB, Flow Cyt, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Noggin antibody - BSA and Azide free (ab281011)
Product image
PerCP/Cy5.5® Anti-Sca1 / Ly6A/E antibody [D7] (ab93538)
Product image
Recombinant human Noggin protein (ab73756)
Product image
HRP Anti-Cripto1/CRIPTO antibody [EPNCIR106A] (ab203468)

Overview

  • Product name

    Anti-Cripto1/CRIPTO antibody
    See all Cripto1/CRIPTO primary antibodies
  • Description

    Rabbit polyclonal to Cripto1/CRIPTO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human Cripto1/CRIPTO aa 100-150 (internal sequence). The exact sequence is proprietary.
    Sequence:

    SFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGC D


    Database link: P13385
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • MDA-MB231 lysate; HeLa and NTERA-2 cells.
  • General notes

     This product was previously labelled as Cripto1

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.88% Sodium chloride, 99% Tris glycine
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Stem Cells
    • Lineage Markers
    • Ectoderm
    • Stem Cells
    • Embryonic Stem Cells
    • Secreted
    • Developmental Biology
    • Embryogenesis
    • Morphogens
    • Developmental Biology
    • Lineage specification
    • Ectoderm

Images

  • Flow Cytometry - Anti-Cripto1/CRIPTO antibody (ab178560)
    Flow Cytometry - Anti-Cripto1/CRIPTO antibody (ab178560)

    Flow cytometric analysis of NTERA-2 cells labeling Cripto1/CRIPTO with ab178560 at 1/50 dilution, detected using Dylight-488 conjugated goat anti-rabbit IgG secondary.

  • Western blot - Anti-Cripto1/CRIPTO antibody (ab178560)
    Western blot - Anti-Cripto1/CRIPTO antibody (ab178560)
    Anti-Cripto1/CRIPTO antibody (ab178560) at 1/1000 dilution + MDA-MB231 lysate

    Predicted band size: 21 kDa

  • Immunocytochemistry/ Immunofluorescence - Anti-Cripto1/CRIPTO antibody (ab178560)
    Immunocytochemistry/ Immunofluorescence - Anti-Cripto1/CRIPTO antibody (ab178560)

    Immunofluorescent analysis of HeLa cells labeling Cripto1/CRIPTO with ab178560 at 1/20 dilution, with Dylight 488 (green). Nuclei were counterstained with DAPI (blue) and tubulin was stained with alpha tubulin (red).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Cripto1/CRIPTO antibody (ab178560)

  •  
  • Product image

    PE Anti-Cripto1/CRIPTO antibody [EPNCIR106A] (ab225077)

    Applications: Flow Cyt

  •  
  • Product image

    Anti-Cripto1/CRIPTO antibody [EPR22230-60] (ab229016)

    Applications: IP, WB

  •  
  • Product image

    HRP Anti-Cripto1/CRIPTO antibody [EPNCIR106A] (ab203468)

    Applications: WB

  •  
  • Product image

    Anti-Cripto1/CRIPTO antibody (ab19917)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    APC Anti-Cripto1/CRIPTO antibody [EPNCIR106A] (ab225076)

    Applications: Flow Cyt

  •  
  • Product image

    Anti-Cripto1/CRIPTO antibody [EPNCIR106A] (ab108391)

    Applications: Flow Cyt, ICC/IF, IP, WB

  •  
  • Product image

    Anti-Cripto1/CRIPTO antibody [EPNCI106B] (ab133236)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-HNF-4-alpha antibody [EPR19265-130] - BSA and Azide free (ab226487)

  •  
  • Product image

    Anti-HSV1 gG Envelope Protein antibody [7F5] (ab6511)

  •  
  • Product image

    Anti-PKC beta 1 antibody [A10-F] (ab136917)

  •  
  • Product image

    Anti-GSK3 beta (phospho S9) + GSK3 alpha (phospho S21) antibody (ab226877)

  •  
  • Product image

    Recombinant human Yes1 protein (Active) (ab101504)

  •  
  • Product image

    Alexa Fluor® 405 Anti-M6PR (cation independent) antibody [EPR6599] - Lysosome Membrane Marker (ab198515)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.