Anti-Cripto1/CRIPTO antibody (ab178560)
Key features and details
- Rabbit polyclonal to Cripto1/CRIPTO
- Suitable for: WB, Flow Cyt, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Cripto1/CRIPTO antibody
See all Cripto1/CRIPTO primary antibodies -
Description
Rabbit polyclonal to Cripto1/CRIPTO -
Host species
Rabbit -
Tested applications
Suitable for: WB, Flow Cyt, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Synthetic peptide within Human Cripto1/CRIPTO aa 100-150 (internal sequence). The exact sequence is proprietary.
Sequence:SFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGC D
Database link: P13385 -
Positive control
- MDA-MB231 lysate; HeLa and NTERA-2 cells.
-
General notes
This product was previously labelled as Cripto1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.88% Sodium chloride, 99% Tris glycine -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Flow cytometric analysis of NTERA-2 cells labeling Cripto1/CRIPTO with ab178560 at 1/50 dilution, detected using Dylight-488 conjugated goat anti-rabbit IgG secondary.
-
Anti-Cripto1/CRIPTO antibody (ab178560) at 1/1000 dilution + MDA-MB231 lysate
Predicted band size: 21 kDa
-
Immunofluorescent analysis of HeLa cells labeling Cripto1/CRIPTO with ab178560 at 1/20 dilution, with Dylight 488 (green). Nuclei were counterstained with DAPI (blue) and tubulin was stained with alpha tubulin (red).

