Anti-Argininosuccinate Lyase antibody (ab97370)
Key features and details
- Rabbit polyclonal to Argininosuccinate Lyase
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-Argininosuccinate Lyase antibody
See all Argininosuccinate Lyase primary antibodies -
Description
Rabbit polyclonal to Argininosuccinate Lyase -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanIHC-P MouseHumanWB MouseHuman -
Immunogen
Recombinant fragment corresponding to Human Argininosuccinate Lyase aa 13-231.
Sequence:FVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQ ILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRS RNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQ RAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVD RELLRAELNFGAITLNSMDAPEATLGPCWGCSCGSDPGVGRAGLGGRPVA LLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYF AQRPGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAP EERPRAPWWDTSSGALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQV LPLDQQLVLVRNCWASLLMLELAQDRLQFETVEVSEPSMLQKILTTRRRE TGGNEPLPVPTLQHHLAPPAEARKVPSASQVQAIKCFLSKCWSLNISTK
Database link: P04424 -
Positive control
- WB: HepG2. HEK-293T, HeLa, A431 whole cell lysate. Neuro2a, GL261, C8D30, NIH/3T3, BCL-1, Raw 264.7, C2C12 whole cell lysate. ICC/IF: HeLa cells IHC-P: U-87 MG xenograft, C2C12 xenograft tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.025% Proclin 300
Constituents: 79% PBS, 20% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Argininosuccinate Lyase antibody (ab97370)
Paraffin embedded C2C12 xenograft tissue stained for ASL using ab97370 at 1/500 dilution in immunohistochemical analysis.
-
HeLa cells stained for ASL (green) using ab97370 at 1/500 dilution in ICC/IF.
-
All lanes : Anti-Argininosuccinate Lyase antibody (ab97370) at 1/1000 dilution
Lane 1 : Neuro2a whole cell lysate
Lane 2 : GL261 whole cell lysate
Lane 3 : C8D30 whole cell lysate
Lane 4 : NIH/3T3 whole cell lysate
Lane 5 : BCL-1 whole cell lysate
Lane 6 : Raw 264.7 whole cell lysate
Lane 7 : C2C12 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 52 kDa10% SDS-PAGE.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Argininosuccinate Lyase antibody (ab97370)
Paraffin embedded U-87 MG xenograft tissue stained for ASL using ab97370 at 1/500 dilution in immunohistochemical analysis.
-
All lanes : Anti-Argininosuccinate Lyase antibody (ab97370) at 1/1000 dilution
Lane 1 : HEK-293T whole cell lysate
Lane 2 : A431 whole cell lysate
Lane 3 : HeLa whole cell lysate
Lane 4 : HepG2 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 52 kDa10% SDS-PAGE.
-
ab97370, at a 1/200 dilution, staining Argininosuccinate Lyase in paraformaldehyde-fixed HeLa cells by Immunofluorescence analysis. Right image is merged with a DNA probe.