Anti-Tankyrase 2/TNKS2 antibody (ab155545)
Key features and details
- Rabbit polyclonal to Tankyrase 2/TNKS2
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Tankyrase 2/TNKS2 antibody -
Description
Rabbit polyclonal to Tankyrase 2/TNKS2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Synthetic peptide corresponding to Human Tankyrase 2/TNKS2 aa 1-44 (N terminal). Carrier-protein conjugated synthetic peptide.
Sequence:MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLV
Database link: Q9H2K2 -
Positive control
- ICC/IF: HeLa cells. WB: Jurkat, Raji, NCI-H929, A431, HeLa and HepG2 whole cell lysates.
-
General notes
Previously labelled as Tankyrase 2.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 10% Glycerol (glycerin, glycerine), 1.21% Tris, 0.75% Glycine -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, labeling Tankyrase 2/TNKS2 (green) with ab155545 at 1/500 dilution. alpha-Tubulin is stained red.
-
All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/500 dilution
Lane 1 : Jurkat whole cell extracts
Lane 2 : Raji whole cell extracts
Lane 3 : NCI-H929 whole cell extracts
Lysates/proteins at 30 µg per lane.
Secondary
All lanes : anti-rabbit IgG antibody at 1/10000 dilution
Predicted band size: 127 kDa10% gel. Running conditions: 80V, 15min; 140V, 40 min. Transfer conditions: Semi-dry, 18 V, 60 min (Nitrocellulose membrane). Blocking: 5% non-fat milk in TBST, RT, 60 min. Primary antibody incubation at 4°C overnight. Washing: 5 ml TBST, 4 x 5 min. ECL exposure.
-
All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/1000 dilution
Lane 1 : A431 whole cell lysate
Lane 2 : HeLa whole cell lysate
Lane 3 : HepG2 whole cell lysate
Lysates/proteins at 30 µg per lane.
Predicted band size: 127 kDa
7.5% SDS PAGE