Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Chromosome Structure Telomeres

Anti-Tankyrase 2/TNKS2 antibody (ab155545)

Price and availability

284 784 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-Tankyrase 2/TNKS2 antibody (ab155545)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to Tankyrase 2/TNKS2
  • Suitable for: WB, ICC/IF
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-Mre11 antibody (ab154480)
Product image
Anti-TEP1 antibody (ab64189)
Product image
Anti-ACD antibody (ab112050)
Product image
Anti-DKC1/Dyskerin antibody (ab93777)

Overview

  • Product name

    Anti-Tankyrase 2/TNKS2 antibody
  • Description

    Rabbit polyclonal to Tankyrase 2/TNKS2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to Human Tankyrase 2/TNKS2 aa 1-44 (N terminal). Carrier-protein conjugated synthetic peptide.
    Sequence:

    MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLV


    Database link: Q9H2K2
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ICC/IF: HeLa cells. WB: Jurkat, Raji, NCI-H929, A431, HeLa and HepG2 whole cell lysates.
  • General notes

    Previously labelled as Tankyrase 2. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 10% Glycerol (glycerin, glycerine), 1.21% Tris, 0.75% Glycine
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Chromosome Structure
    • Telomeres
    • Signal Transduction
    • Protein Trafficking
    • Vesicle Transport
    • Regulation

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-Tankyrase 2/TNKS2 antibody (ab155545)
    Immunocytochemistry/ Immunofluorescence - Anti-Tankyrase 2/TNKS2 antibody (ab155545)

    Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, labeling Tankyrase 2/TNKS2 (green) with ab155545 at 1/500 dilution. alpha-Tubulin is stained red.

  • Western blot - Anti-Tankyrase 2/TNKS2 antibody (ab155545)
    Western blot - Anti-Tankyrase 2/TNKS2 antibody (ab155545)
    All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/500 dilution

    Lane 1 : Jurkat whole cell extracts
    Lane 2 : Raji whole cell extracts
    Lane 3 : NCI-H929 whole cell extracts

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : anti-rabbit IgG antibody at 1/10000 dilution

    Predicted band size: 127 kDa



    10% gel. Running conditions: 80V, 15min; 140V, 40 min. Transfer conditions: Semi-dry, 18 V, 60 min (Nitrocellulose membrane). Blocking: 5% non-fat milk in TBST, RT, 60 min. Primary antibody incubation at 4°C overnight. Washing: 5 ml TBST, 4 x 5 min. ECL exposure. 

  • Western blot - Anti-Tankyrase 2/TNKS2 antibody (ab155545)
    Western blot - Anti-Tankyrase 2/TNKS2 antibody (ab155545)
    All lanes : Anti-Tankyrase 2/TNKS2 antibody (ab155545) at 1/1000 dilution

    Lane 1 : A431 whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : HepG2 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 127 kDa



    7.5% SDS PAGE

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Clear all

Recently viewed products

  •  
  • Product image

    Phospho-ATF2 (T69/71) and Total ATF2 ELISA Kit (ab279738)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.