Recombinant Rat IL-2 protein (His tag) (ab215022)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
-
Product name
Recombinant Rat IL-2 protein (His tag)
See all IL-2 proteins and peptides -
Purity
>= 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Rat -
Sequence
APTSSPAKETQQHLEQLLLDLQVLLRGIDNYKNLKLPMMLTFKFYLPKQA TELKHLQCLENELGALQRVLDLTQSKSFHLEDAGNFISNIRVTVVKLKGS ENKFECQFDDEPATVVEFLRRWIAICQSIISTMTQ -
Predicted molecular weight
16 kDa -
Amino acids
21 to 155 -
Tags
His tag C-Terminus -
Additional sequence information
This product is the mature full length protein from aa 21 to 155. The signal peptide is not included (NP_446288.1).
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab215022 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilised from 0.2µm filtered solution. -
ReconstitutionReconstitute in sterile H2O at not less than 100 µg/mL, which can then be further diluted in other aqueous solutions.
General Info
-
Alternative names
- Aldesleukin
- IL 2
- IL-2
see all -
Function
Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells. -
Involvement in disease
Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17. -
Sequence similarities
Belongs to the IL-2 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215022 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Lyophilised from 0.2µm filtered solution. -
ReconstitutionReconstitute in sterile H2O at not less than 100 µg/mL, which can then be further diluted in other aqueous solutions.