Recombinant rat FGF21 protein (ab202819)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: > 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
-
Product name
Recombinant rat FGF21 protein
See all FGF21 proteins and peptides -
Biological activity
ab202819 is fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/mL, corresponding to a specific activity of > 2.0 × 103 IU/mg in the presence of 5 µg/mL of rMuKlotho-β and 10 μg/mL of heparin.
-
Purity
> 95 % SDS-PAGE.
Purity is determined by SDS-PAGE and HPLC analyses. -
Endotoxin level
> 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
AYPISDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGTAHRSP ESLLELKALKPGVIQILGVKASRFLCQQPDGTLYGSPHFDPEACSFRELL LKDGYNVYQSEAHGLPLRLPQKDSQDPATRGPVRFLPMPGLPHEPQEQPG VLPPEPPDVGSSDPLSMVEPLQGRSPSYAS -
Predicted molecular weight
20 kDa -
Amino acids
29 to 208 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included. A single non-glycosylated polypeptide chain.
-
Preparation and Storage
-
Alternative names
- FGF 21
- FGF-21
- Fgf21
see all -
Function
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. -
Sequence similarities
Belongs to the heparin-binding growth factors family. -
Cellular localization
Secreted. - Information by UniProt
