• Product name

  Recombinant Rabbit IL-17A protein
  See all IL-17A proteins and peptides

• Purity

  > 95 % SDS-PAGE.
  ab209282 is purified by Ion-exchange chromatography.
  

• Expression system

  Yeast

• Protein length

  Full length protein

• Animal free

  No

• Nature

  Recombinant

• • Species

    Rabbit

  • Sequence

    GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWT LHRNEDHERYPSVIWEAKCRHLGCVNAEGNVDHHMNSVPIQQEILVLRRE SQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

  • Predicted molecular weight

    15 kDa

  • Amino acids

    24 to 153

  • Additional sequence information

    This product is for the mature full length protein. The signal peptide is not included.

• Alternative names

  • CTLA 8
  • CTLA-8
  • CTLA8

  • cytotoxic T lymphocyte associated antigen 8
  • Cytotoxic T lymphocyte associated protein 8
  • Cytotoxic T lymphocyte associated serine esterase 8
  • Cytotoxic T-lymphocyte-associated antigen 8
  • IL 17
  • IL 17A
  • IL-17
  • IL-17A
  • IL17
  • IL17_HUMAN
  • Il17a
  • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
  • interleukin 17A
  • Interleukin-17A
  • interleukin17
  • Interleukin17A
  • OTTHUMP00000016597
  • OTTMUSP00000046003

  see all

• Function

  Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.

• Tissue specificity

  Restricted to activated memory T-cells.

• Sequence similarities

  Belongs to the IL-17 family.

• Post-translational
  modifications

  Found both in glycosylated and nonglycosylated forms.

• Cellular localization

  Secreted.

• Target information above from: UniProt accession Q16552 The UniProt Consortium
  The Universal Protein Resource (UniProt) in 2010
  Nucleic Acids Res. 38:D142-D148 (2010) .

  Information by UniProt