Recombinant cow IL-17A protein (ab209285)
Key features and details
- Expression system: Yeast
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant cow IL-17A protein
See all IL-17A proteins and peptides -
Biological activity
Bovine peripheral blood mononuclear cells demonstrated increased expression of IL6 and IL8 as measured by RT-PCR following two days stimulation with 300 ng/mL of ab209285.
-
Purity
> 95 % SDS-PAGE.
ab209285 is purified by Ion-exchange chromatography. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Cow -
Sequence
KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSP WTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLR RESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA -
Predicted molecular weight
17 kDa -
Amino acids
22 to 153 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituents: 90% PBS, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.