Recombinant rat CXCL2 protein (ab201362)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
-
Product name
Recombinant rat CXCL2 protein
See all CXCL2 proteins and peptides -
Biological activity
Fully biologically active when compared to standard.
The biological activity determined by a chemotaxis bioassay using Rat neutrophils is in a concentration range of 10-100 ng/mL.
-
Purity
> 98 % SDS-PAGE.
> 98 % by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Rat -
Sequence
VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN -
Predicted molecular weight
8 kDa -
Amino acids
28 to 100 -
Additional sequence information
Single, non-glycosylated polypeptide chain containing 73 amino acids.
-
Preparation and Storage
-
Alternative names
- C-X-C motif chemokine 2
- Chemokine (C X C motif) ligand 2
- Chemokine, CXC motif, ligand 2
see all -
Function
Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsThe N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. -
Cellular localization
Secreted. - Information by UniProt