• Product name

  Recombinant human TNFSF18/GITRL protein
  See all TNFSF18/GITRL proteins and peptides

• Biological activity

  Biological activity: Use at a concentration of 1 - 10 ng/ml to stimulate IL8 production by human PBMC. Results may vary with PBMC donors.

• Purity

  > 95 % SDS-PAGE.
  Greater than 98% by SDS-PAGE and HPLC analyses.
  

• Expression system

  Escherichia coli

• Protein length

  Protein fragment

• Animal free

  No

• Nature

  Recombinant

• • Species

    Human

  • Sequence

    METAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQ VAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDL IFNSEHQVLKNNTYWGIILLANPQFI

  • Amino acids

    52 to 176

  • Additional sequence information

    Contains 127 amino acid residues corresponding to the extracellular domain of TNFS18 / GITRL.

• Alternative names

  • Activation inducible TNF related ligand
  • Activation-inducible TNF-related ligand
  • AITR ligand

  • AITRL
  • GITR ligand
  • GITRL
  • Glucocorticoid induced TNF related ligand
  • Glucocorticoid induced TNFR related protein ligand
  • Glucocorticoid-induced TNF-related ligand
  • hGITRL
  • MGC138237
  • TL6
  • TNF18_HUMAN
  • TNFSF18
  • TNLG2A
  • Tumor necrosis factor (ligand) superfamily member 18
  • Tumor necrosis factor ligand 2A
  • Tumor necrosis factor ligand superfamily member 18

  see all

• Function

  Cytokine that binds to TNFRSF18/AITR/GITR. Important for interactions between activated T-lymphocytes and endothelial cells and may modulate T-lymphocyte survival in peripheral tissues.

• Tissue specificity

  Expressed at high levels in the small intestine, ovary, testis, kidney and endothelial cells.

• Sequence similarities

  Belongs to the tumor necrosis factor family.

• Cellular localization

  Membrane.

• Target information above from: UniProt accession Q9UNG2 The UniProt Consortium
  The Universal Protein Resource (UniProt) in 2010
  Nucleic Acids Res. 38:D142-D148 (2010) .

  Information by UniProt