Recombinant Human PLGF protein (ab84148)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human PLGF protein
See all PLGF proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALER LVDVVSEYP SEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQ LLKIRSGDR PSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 1% Human serum albumin, 10% Trehalose
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Images
-
Functional Studies - Recombinant Human PLGF protein (ab84148)Densitometry of protein isoforms visualised by 2-DE.
The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
The triangle indicates the theoretical MW and pI of the protein. -
SDS-PAGE - Recombinant Human PLGF protein (ab84148)1D SDS-PAGE of ab84148 before and after treatment with glycosidases to remove oligosaccharides.
Lane 1: ab84148
Lane 2: ab84148 treated with PNGase F to remove potential N-linked glycans
Lane 3: ab84148 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
10μg protein loaded per lane; Deep Purple™ stained. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.
