Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Neuroscience Neurology process Growth and Development Neurotrophins

Recombinant Human NRG1 protein (ab176957)

Recombinant Human NRG1 protein (ab176957)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Suitable for: HPLC, SDS-PAGE

You may also be interested in

Product image
Human Midkine ELISA Kit (ab193761)
Product image
Anti-p75 NGF Receptor antibody (ab227509)
Recombinant human NRG1 protein (Active) (ab200238)
Recombinant Mouse GDNF Receptor alpha 1/GFRA1 protein (His tag) (ab267982)

Description

  • Product name

    Recombinant Human NRG1 protein
    See all NRG1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by HPLC and SDS-PAGE.
  • Expression system

    Escherichia coli
  • Accession

    Q02297-7
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSHLVKCAEKEKTFCVNGGECFMVKDLSNP SRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
    • Predicted molecular weight

      7 kDa
    • Amino acids

      177 to 237
    • Additional sequence information

      The protein sequence corresponds to isoform 7 of human NRG1 protein.

Preparation and Storage

  • Alternative names

    • Acetylcholine receptor-inducing activity
    • Acetylcholine receptor-inducing activity, CHICK, homolog of
    • ARIA
    • Breast cancer cell differentiation factor p45
    • GGF
    • GGF2
    • Glial growth factor
    • Heregulin
    • heregulin, alpha (45kD, ERBB2 p185-activator)
    • HGL
    • HRG
    • HRG1
    • HRGA
    • MST131
    • NDF
    • Neu differentiation factor
    • Neuregulin 1
    • neuregulin 1 type IV beta 1a
    • neuregulin 1 type IV beta 3
    • Neuregulin-1
    • NRG 1
    • nrg1
    • NRG1-IT2
    • NRG1_HUMAN
    • OTTHUMP00000225398
    • OTTHUMP00000225419
    • OTTHUMP00000225420
    • OTTHUMP00000225421
    • OTTHUMP00000225422
    • OTTHUMP00000225477
    • OTTHUMP00000225545
    • OTTHUMP00000230603
    • OTTHUMP00000230605
    • pro-neuregulin-1, membrane-bound isoform
    • Pro-NRG1
    • ProNRG1
    • Sensory and motor neuron-derived factor
    • SMDF
    see all
  • Function

    Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development.
  • Tissue specificity

    Type I isoforms are the predominant forms expressed in the endocardium. Isoform alpha is expressed in breast, ovary, testis, prostate, heart, skeletal muscle, lung, placenta liver, kidney, salivary gland, small intestine and brain, but not in uterus, stomach, pancreas, and spleen. Isoform 3 is the predominant form in mesenchymal cells and in non-neuronal organs, whereas isoform 6 is the major neuronal form. Isoform 8 is expressed in spinal cord and brain. Isoform 9 is the major form in skeletal muscle cells; in the nervous system it is expressed in spinal cord and brain. Also detected in adult heart, placenta, lung, liver, kidney, and pancreas. Isoform 10 is expressed in nervous system: spinal cord motor neurons, dorsal root ganglion neurons, and brain. Predominant isoform expressed in sensory and motor neurons. Not detected in adult heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Not expressed in fetal lung, liver and kidney. Type IV isoforms are brain-specific.
  • Involvement in disease

    Note=A chromosomal aberration involving NRG1 produces gamma-heregulin. Translocation t(8;11) with ODZ4. The translocation fuses the 5'-end of ODZ4 to NRG1 (isoform 8). The product of this translocation was first thought to be an alternatively spliced isoform. Gamma-heregulin is a soluble activating ligand for the ERBB2-ERBB3 receptor complex and acts as an autocrine growth factor in a specific breast cancer cell line (MDA-MB-175). Not detected in breast carcinoma samples, including ductal, lobular, medullary, and mucinous histological types, neither in other breast cancer cell lines.
  • Sequence similarities

    Belongs to the neuregulin family.
    Contains 1 EGF-like domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Developmental stage

    Detectable at early embryonic ages. Isoform 10 is highly expressed in developing spinal motor neurons and in developing cranial nerve nuclei. Expression is maintained only in both adult motor neurons and dorsal root ganglion neurons. Type IV isoforms are expressed in fetal brain.
  • Domain

    The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization.
    ERBB receptor binding is elicited entirely by the EGF-like domain.
  • Post-translational
    modifications

    Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
    N- and O-glycosylated. Extensive glycosylation precedes the proteolytic cleavage.
  • Cellular localization

    Secreted; Cell membrane. Does not seem to be active; Membrane. May possess an internal uncleaved signal sequence; Nucleus. May be nuclear and Secreted. Has a signal peptide.
  • Target information above from: UniProt accession Q02297 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human NRG1 protein (ab176957)
    SDS-PAGE - Recombinant Human NRG1 protein (ab176957)

    15% SDS-PAGE analysis of ab176957 (20 μg).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human NRG1 protein (ab176957)

  •  
  • Recombinant human NRG1 protein (ab50227)

    Applications: FuncS, SDS-PAGE

  •  
  • Recombinant human NRG1 protein (Active) (ab200238)

    Applications: FuncS, HPLC, SDS-PAGE

  •  
  • Product image

    Recombinant human NRG1 protein (Active) (ab242321)

    Applications: FuncS, HPLC, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Recombinant Human PRADC1 protein (ab194026)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.