Recombinant Human Nanog protein (ab245793)
Key features and details
- Expression system: Escherichia coli
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human Nanog protein
See all Nanog proteins and peptides -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETV SPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTV FSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSK RWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTW NNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSC MQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQ PEDVGGYGRKKRRQRRR -
Predicted molecular weight
36 kDa -
Amino acids
2 to 305 -
Additional sequence information
Plus a 13-residue C-terminal TAT peptide.
-
Preparation and Storage
-
Alternative names
- Embryonic stem cell specific homeobox protein (Nanog)
- ENK
- FLJ12581
see all -
Function
Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes (By similarity). Acts as a transcriptional activator or repressor (By similarity). Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3' (By similarity). When overexpressed, promotes cells to enter into S phase and proliferation. -
Tissue specificity
Expressed in testicular carcinoma and derived germ cell tumors (at protein level). Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes. -
Sequence similarities
Belongs to the Nanog homeobox family.
Contains 1 homeobox DNA-binding domain. -
Developmental stage
Expressed in embryonic stem (ES) and carcinoma (EC) cells. Expressed in inner cell mass (ICM) of the blastocyst and gonocytes between 14 and 19 weeks of gestation (at protein level). Not expressed in oocytes, unfertilized oocytes, 2-16 cell embryos and early morula (at protein level). Expressed in embryonic stem cells (ES). Expression decreases with ES differentiation. -
Cellular localization
Nucleus. - Information by UniProt