Recombinant human IL-8 protein (Animal Free) (ab217416)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, HPLC, Functional Studies
-
Product name
Recombinant human IL-8 protein (Animal Free)
See all IL-8 proteins and peptides -
Biological activity
Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 10.0-100.0 ng/ml.
-
Purity
> 98 % SDS-PAGE.
> 98% by HPLC analysis. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELC LDPKENWVQRVVEKFLKRAENS -
Predicted molecular weight
8 kDa -
Amino acids
28 to 99 -
Additional sequence information
Corresponding to IL-8(6-77) chain
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionLyophilised from a sterile filtered solution. Centrifuge the vial prior to opening. Reconstitute in Water to a concentration of 0.1 - 1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20C to -80C
