Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
-
Product name
Recombinant human IL-2 Receptor alpha protein (Fc Chimera)
See all IL-2 Receptor alpha proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTG NSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVD QASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAE SVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSC LVTTTDFQIQTEMAATMETSIFTTGIPKVDKKVEPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK -
Amino acids
22 to 237
-
Preparation and Storage
-
Alternative names
- Interleukin 2 receptor alpha chain
- CD25
- CD25 antigen
see all -
Function
Receptor for interleukin-2. -
Involvement in disease
Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. -
Sequence similarities
Contains 2 Sushi (CCP/SCR) domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)1D SDS-PAGE of ab84071 before and after treatment with glycosidases to remove oligosaccharides.
Lane 1: ab84071
Lane 2: ab84071 treated with PNGase F to remove potential N-linked glycans
Lane 3: ab84071 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
10 μg protein loaded per lane; Deep Purple™ stained. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Subsequent tightening of band after treatment with glycosidase cocktail suggests presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes. -
SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)A sample of ab84071 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel.
40μg protein loaded per lane; Deep Purple™ stained. Spot train indicates presence of multiple isoforms. Spots within the spot train were cut from the gel and identified as IL2 Receptor alpha (Fc Chimera) by protein mass fingerprinting. -
Functional Studies - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)Densitometry of protein isoforms visualised by 2-DE.
The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
The triangle indicates the theoretical MW and pI of the protein.
