Recombinant human IL-10 protein (Animal Free) (ab187204)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human IL-10 protein (Animal Free)
See all IL-10 proteins and peptides -
Biological activity
Determined by the dose-dependant proliferation of mouse MC-9 cells and is typically less than 0.5 ng/mL.
-
Purity
> 97 % SDS-PAGE.
Reducing and non-reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
YesNature
Recombinant-
Species
Human -
Sequence
MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLK ESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLK TLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINY IEAYMTMKIRN -
Predicted molecular weight
17 kDa -
Amino acids
19 to 178 -
Additional sequence information
Mature form. Non-glycosylated.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab187204 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
Constituent: 0.14% Sodium phosphate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. Reconstituted material should be aliquoted and frozen at -20°C.
General Info
-
Alternative names
- CSIF
- Cytokine synthesis inhibitory factor
- GVHDS
see all -
Function
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. -
Tissue specificity
Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types. -
Sequence similarities
Belongs to the IL-10 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab187204 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
Constituent: 0.14% Sodium phosphate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionCentrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mg/mL, which can be further diluted into other aqueous solutions. Reconstituted material should be aliquoted and frozen at -20°C.
