Recombinant Human FGF 23 protein (ab104163)
Key features and details
- Expression system: Escherichia coli
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, WB
-
Product name
Recombinant Human FGF 23 protein
See all FGF 23 proteins and peptides -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKHHHHHHASAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMA SDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI -
Predicted molecular weight
9 kDa including tags -
Amino acids
180 to 251 -
Tags
His tag N-Terminus
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -80°C.
Constituents: 0.242% Tris, 0.29% Sodium chloride
-
ReconstitutionAdd deionized water to prepare a working stock solution of 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.
Images
-
SDS-PAGE - Recombinant Human FGF 23 protein (ab104163)14% SDS-PAGE:
Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
Lane 2: Reduced and boiled sample, 5μg/lane.
Lane 3: Non-reduced and non-boiled sample, 5μg/lane.
