Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Macrophage / Inflamm.

Recombinant Human CD163 protein (ab112384)

Recombinant Human CD163 protein (ab112384)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Wheat germ
  • Suitable for: ELISA, SDS-PAGE, WB

You may also be interested in

Product image
Human Galectin 10 ELISA Kit (ab277447)
Recombinant Human Macrophage Inflammatory Protein 3 alpha (Fc Chimera) (ab216229)
Product image
Anti-Mast Cell Tryptase antibody (ab231714)
Product image
Anti-C5a antibody [7L11] (ab194637)

Description

  • Product name

    Recombinant Human CD163 protein
    See all CD163 proteins and peptides
  • Biological activity

    Useful for Antibody Production and Protein Array
  • Expression system

    Wheat germ
  • Accession

    Q86VB7
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESAL WDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMC
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      78 to 168

Preparation and Storage

  • Alternative names

    • C163A_HUMAN
    • CD 163
    • CD163
    • CD163 antigen
    • CD163 molecule
    • Hemoglobin scavenger receptor
    • M130
    • M130 antigen precursor
    • Macrophage associated antigen
    • MM130
    • OTTHUMP00000238617
    • OTTHUMP00000238618
    • OTTHUMP00000238619
    • OTTHUMP00000238620
    • SCARI1
    • Scavenger receptor cysteine rich type 1 protein M130
    • sCD163
    • Soluble CD163
    see all
  • Function

    Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells.
    After shedding, the soluble form (sCD163) may play an anti-inflammatory role, and may be a valuable diagnostic parameter for monitoring macrophage activation in inflammatory conditions.
  • Tissue specificity

    Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen, cortical macrophages in the thymus, resident bone marrow macrophages and meningeal macrophages of the central nervous system. Expressed also in blood. Isoform 1 is the lowest abundant in the blood. Isoform 2 is the lowest abundant in the liver and the spleen. Isoform 3 is the predominant isoform detected in the blood.
  • Sequence similarities

    Contains 9 SRCR domains.
  • Domain

    The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.
  • Post-translational
    modifications

    A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs.
    Phosphorylated.
  • Cellular localization

    Secreted and Cell membrane. Isoform 1 and isoform 2 show a lower surface expression when expressed in cells.
  • Target information above from: UniProt accession Q86VB7 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant Human CD163 protein (ab112384)
    SDS-PAGE - Recombinant Human CD163 protein (ab112384)
    ab112384 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant Human CD163 protein (ab112384)

  •  
  • Product image

    Recombinant Human CD163 protein (His tag) (ab219873)

    Applications: SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Cytokeratin 17 antibody [SP95] - C-terminal (ab183330)

  •  
  • Product image

    Anti-Fos B antibody [83B1138] (ab11959)

  •  
  • Product image

    Anti-Kaiso antibody [6F / 6F8] (ab12723)

  •  
  • Product image

    Anti-Human IgG Fab fragment antibody [4A11] (ab771)

  •  
  • Product image

    Alexa Fluor® 488 Anti-beta III Tubulin antibody [2G10] (ab195879)

  •  
  • Product image

    Anti-Extracellular matrix protein 1 antibody [SC05] (ab233863)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.