Recombinant human CD160 protein (Fc Chimera) (ab214121)
Key features and details
- Expression system: CHO cells
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human CD160 protein (Fc Chimera)
See all CD160 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA.
-
Purity
> 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQ LRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGH FFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS -
Predicted molecular weight
20 kDa -
Amino acids
27 to 159 -
Additional sequence information
Mature extracellular form, without signal peptide, without propeptide, fused to the N-terminus of the Fc region of human IgG1.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab214121 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: PBS
Lyophilized from 0.2µm-filtered solutionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- BY55
- BY55_HUMAN
- CD160
see all -
Function
Receptor showing broad specificity for both classical and non-classical MHC class I molecules. -
Tissue specificity
Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214121 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: PBS
Lyophilized from 0.2µm-filtered solutionThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.