Recombinant human BMP2 protein (Fc Chimera) (ab214607)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human BMP2 protein (Fc Chimera)
See all BMP2 proteins and peptides -
Biological activity
Shows the biological function of the BMP-2 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain in vivo. Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 2.0 -3.5μg/ml.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
RKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLN STNH AIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQ DMVVEGCGCR -
Amino acids
289 to 396 -
Additional sequence information
The extracellular domain of Human BMP2 (aa 289-396) is fused to the N-terminus of the Fc region of a mutant Human IgG1 (NP_001191.1).
Associated products
Specifications
Our Abpromise guarantee covers the use of ab214607 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 100% PBS
0.2µm-filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in 50µl sterile water. Add 1X PBS to the desired protein concentration.
General Info
-
Alternative names
- BDA2
- BMP-2
- BMP-2A
see all -
Function
Induces cartilage and bone formation. -
Tissue specificity
Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214607 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- BDA2
- BMP-2
- BMP-2A
see all -
Function
Induces cartilage and bone formation. -
Tissue specificity
Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine. -
Sequence similarities
Belongs to the TGF-beta family. -
Cellular localization
Secreted. - Information by UniProt