Recombinant human ADAMTS1 protein (ab134430)
Key features and details
- Expression system: Baculovirus infected insect cells
- Purity: > 90% SDS-PAGE
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE, Inhibition Assay
-
Product name
Recombinant human ADAMTS1 protein -
Biological activity
Activity of ab134430 is determined with recombinant aggrecan interglobular domain. ab134430 hydrolyzes the aggrecanase site within this domain (peptide bond E373 - A374 in Human aggrecan). The recombinant substrate is incubated at a concentration of 0.1 µM with 0.2-3.0 nM ADAMTS1 in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM CaCl2, 1 µM leupeptin, 1 µM pepstatin, 1 mM Pefabloc, 0.05 % Brij 35 for 15 min at 37°C. Cleavage at the aggrecanase-site is estimated from the appearance of the hydrolysis fragment with the novel N-terminus ARGSVIL. The fragment is quantified with two monoclonal antibodies, one directed against the neoepitope ARGSVIL, the other against the sequence C-terminal to the neoepitope. Under the specified conditions the hydrolysis rate is > 0.06 nM hydrolysed substrate/min x nM truncated ADAMTS1. When related to mg enzyme, the value is > 1.4 nmoles hydrolyzed substrate/min x mg ADAMTS1. -
Purity
> 90 % SDS-PAGE.
ab134430 was purified from insect cell culture supernatants. -
Expression system
Baculovirus infected insect cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSV SLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDT AILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHE LGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMIT SFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDA ASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRK HFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKR VRYRSCNLEDCPDN(H)6 -
Predicted molecular weight
41 kDa including tags -
Amino acids
253 to 616 -
Tags
His tag C-Terminus
-
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 7.50
Constituents: 0.05% Brij, 0.05% Calcium chloride, 0.79% Tris HCl, 0.88% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.