Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Antibodies gfp

FITC Anti-GFP antibody (ab6662)

Price and availability

335 040 ₸

Availability

Order now and get it on Wednesday March 10, 2021

FITC Anti-GFP antibody (ab6662)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • FITC Goat polyclonal to GFP
  • Suitable for: IHC-FoFr, IHC-Fr, WB, ICC/IF
  • Reacts with: Drosophila melanogaster, Species independent
  • Conjugation: FITC. Ex: 493nm, Em: 528nm
  • Isotype: IgG

You may also be interested in

Product image
Anti-GFP antibody [GF28R] (ab127417)
Product image
Anti-GFP antibody (ab6556)
Product image
Anti-GFP antibody [EPR14104] (ab183734)
Anti-GFP antibody (ab92456)

Overview

  • Product name

    FITC Anti-GFP antibody
    See all GFP primary antibodies
  • Description

    FITC Goat polyclonal to GFP
  • Host species

    Goat
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested Applications & Species

    Application Species
    IF
    Species independent
    IHC-Fr
    Species independent
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to GFP aa 1-246.
    Sequence:

    MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTT GKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFF KDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNV YIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK


    Database link: P42212
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant A. victoria GFP protein.
  • General notes

    Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation. Fluorescein conjugated anti-GFP was assayed by immunofluorescence microscopy on prokaryotic (E.coli) and eukaryotic (CHO cells) expression systems and was shown to detect GFP containing inserts. Significant amplification of signal was detected using fluorochrome conjugated anti-GFP relative to the fluorescence of GFP alone.
    In case of unexpected background, use pre-adsorbed secondary antibodies.

    Fluorescein isothiocyanate (FITC) (MW 390 daltons) Absorption Wavelength: 495 nm Emission Wavelength: 528 nm Fluorochrome/Protein Ratio: 3.5 moles FITC per mole of Goat IgG

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.01% Sodium azide
    Constituents: 0.42% Potassium phosphate, 0.87% Sodium chloride, 1% BSA

    BSA Immunoglobulin and Protease free
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    GFP Fluorescein Conjugated Antibody was prepared from monospecific antiserum by immunoaffinity chromatography using Green Fluorescent Protein (Aequorea victoria) coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities.
  • Primary antibody notes

    Designed to detect GFP and its variants in ELISA (sandwich or capture), immunoblotting and immunoprecipitation. Fluorescein conjugated anti-GFP was assayed by immunofluorescence microscopy on prokaryotic (E.coli) and eukaryotic (CHO cells) expression systems and was shown to detect GFP containing inserts. Significant amplification of signal was detected using fluorochrome conjugated anti-GFP relative to the fluorescence of GFP alone.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Tags & Cell Markers
    • Fusion / Marker Proteins
    • GFP

Images

  • Western blot - FITC Anti-GFP antibody (ab6662)
    Western blot - FITC Anti-GFP antibody (ab6662)
    FITC Anti-GFP antibody (ab6662) + Recombinant A. victoria GFP protein (ab84191)

    Secondary
    Fluorescein goat secondary antibody for 60 minutes at RT at 1/1000 dilution


    Block: Blocking buffer for 30 minutes at RT.

  • Immunofluorescence - FITC Anti-GFP antibody (ab6662)
    Immunofluorescence - FITC Anti-GFP antibody (ab6662) Kim at el PLoS Genet. 2018 Feb 8;14(2):e1007204. doi: 10.1371/journal.pgen.1007204. eCollection 2018 Feb. Fig 4. Reproduced under the Creative Commons license http://creativecommons.org/licenses/by/4.0/

    Oscillation of Cyclin E and E2F target gene expression is deregulated in de2f1b mutant salivary glands.

    Salivary glands of control and de2f1b mutant early (80–85 hr AEL) third instar larvae expressing PCNA-GFP (green, ab6662) are stained with anti-dE2F1 (red). The region where high PCNA-GFP is observed with low dE2F1 is marked by an asterisk.

    For Immunostaining, third instar imaginal discs and salivary glands were dissected in PBS and immediately fixed in 4% formaldehyde in PBS for 20 minutes at room temperature with the exception of tissues subjected to anti-dE2F1 staining that were fixed for 30 minutes on ice. Fixed tissues were then washed with 0.3% PBST (0.3% TritonX-100 in 1XPBS) and 0.1% PBST (0.1% TritonX-100 in 1XPBS). Samples were incubated with appropriate amount of primary antibody in 0.1% PBST and 1%BSA overnight. Samples were then washed with 0.1% PBST, incubated in secondary antibody in 0.1% PBST and 1% BSA for 2 hours, followed by several washes in 0.1% PBST prior to mounting.

  • Immunofluorescence - FITC Anti-GFP antibody (ab6662)
    Immunofluorescence - FITC Anti-GFP antibody (ab6662)

    Immunofluorescence Microscopy using ab6662.

    Tissue: Drosophila melanogaster late stage embryonic central nervous system.

    Fixation: 0.5% PFA.

    Antigen retrieval: Not required.

    Primary antibody: Anti-GFP antibody at a 1/1,000 for 1 h at RT.

    Secondary antibody: AlexaFluor 488™ conjugated anti-Goat antibody at 1/300 for 45 minutes at RT.

    Panel A: shows a lateral view (ventral left).

    Panels B and C: shows ventral views of whole mount embryos at 63x magnification (plus 2x digital zoom).

    In all panels, anterior is up.

    Staining: tau-GFP cell bodies (large arrowhead) and axons of motorneurons (arrow) and interneurons (small arrowhead) as green fluorescent signal.

  • Immunohistochemistry (Frozen sections) - FITC Anti-GFP antibody (ab6662)
    Immunohistochemistry (Frozen sections) - FITC Anti-GFP antibody (ab6662) This image is courtesy of an Abreview submitted by Dr Joshua Breunig

    ab6662 staining mouse brain tissue sections (inducible GFP reporter) by IHC-Fr.

    The tissue was paraformaldehyde fixed and blocked with serum and then incubated with the antibody at a 1/1000 dilution for 1 hour.

    Staining is shown in the left hand panel. The middle panel shows staining with a rabbit anti-GFP antibody and the right hand panel shows the merged images (plus DAPI).

    ab6662 gives no noticable background and it is found that when viewing on an epifluorescent the exposure time is significantly reduced.

    See Abreview

  • Immunohistochemistry (Frozen sections) - FITC Anti-GFP antibody (ab6662)
    Immunohistochemistry (Frozen sections) - FITC Anti-GFP antibody (ab6662)

    Immunofluorescence Microscopy using ab6662.

    Tissue: Sf-1:Cre mice crossed to the Z/EG reporter line. Mouse brain (coronal view, 20X magnification).

    Fixation: 4% PFA/PBS with o/n fixation, and subsequently transferred to a 30% sucrose solution.

    Antigen retrieval: Frozen in OCT freezing medium (Sakura) and cryostat sectioned at 40 microns.

    Goat anti-GFP was used at 1/500 dilution in free floating imunnohistochemistry to detect GFP.

    Secondary antibody: Fluorchrome conjugated Anti-goat IgG secondary antibody was used for detection at 1:500 at 1/10,000 for 45 minutes at RT.

    Localization: Sf-1+ neurons and their processes of the ventromedial nucleus of the hypothalamus.

    Staining: eGFP as green fluorescent signal and sections were counterstained with DAPI.

  • Immunohistochemistry (Frozen sections) - FITC Anti-GFP antibody (ab6662)
    Immunohistochemistry (Frozen sections) - FITC Anti-GFP antibody (ab6662)

    These pictures show confocal immunofluorescence using GFP-expressing glial cells (green) transplanted into the lesioned rat spinal cord.

    Detected using ab6662 and a standard FITC filter set. Axons are labeled red by an antibody to neurofilament-200 and a rhodamine secondary antibody. The upper panel shows the centre of the transplant site at low power. Numerous GFP-positive cells can be seen mingling with axons. The lower panel shows, at high power in a single optical section, how ab6662 reveals the morphology of the transplanted cells to such an extent that their close interactions with axons are obvious - the cell depicted can be seen wrapping around a neurofilament-200 positive axon.

    These images were kindly supplied as part of the review submitted by Andrew Toft.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to FITC Anti-GFP antibody (ab6662)

  •  
  • Product image

    Anti-GFP antibody [E385] - BSA and Azide free (ab239807)

    Applications: WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104-89] - BSA and Azide free (ab236117)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104] (ab183734)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104] - BSA and Azide free (ab220802)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-GFP antibody [E385] (ab32146)

    Applications: WB

  •  
  • Product image

    Anti-GFP antibody [EPR14104-89] (ab183735)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    HRP Anti-GFP antibody [E385] (ab190584)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Recombinant Staphylococcus aureus HlgC protein (His tag) (ab241242)

  •  
  • Anti-Ochratoxin A antibody (ab35133)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.