Anti-xCT antibody (ab37185)
Key features and details
- Rabbit polyclonal to xCT
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-xCT antibody
See all xCT primary antibodies -
Description
Rabbit polyclonal to xCT -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human xCT aa 1-50 (N terminal). The exact sequence is proprietary.
Sequence:MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGV
Database link: Q9UPY5
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
Affinity purified antibody. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-xCT antibody (ab37185)All lanes : Anti-xCT antibody (ab37185) at 0.5 µg/ml
Lane 1 : Total human stomach lysate.
Lane 2 : Total mouse stomach lysate.
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 55 kDa
Observed band size: 55 kDa
Exposure time: 1 minute
-
Immunocytochemistry/ Immunofluorescence - Anti-xCT antibody (ab37185)Imunocytochemistry/ Immunofluorescence analysis of HepG2 cells labeling xCT with ab37185 followed by Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red) respectively.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-xCT antibody (ab37185)Immunohistochemical analysis of small intestine labeling xCT with ab37185. Staining is observed in the absorptive epithelia of small intestinal villi.
-
Western blot - Anti-xCT antibody (ab37185)All lanes : Anti-xCT antibody (ab37185)
Lane 1 : Human Stomach Cancer tissue lysate
Lane 2 : HepG2 cell lysate
Lysates/proteins at 0.5 mg/ml per lane.
Predicted band size: 55 kDaThis experiment was performed under reducing conditions using the 12-230 kDa separation system. * Non-specific interaction with the 230 kDa.
