Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
Key features and details
- Mouse monoclonal [1C5H11] to TGF beta Receptor III/TGFBR3
- Suitable for: WB, ELISA
- Reacts with: Mouse, Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11]
See all TGF beta Receptor III/TGFBR3 primary antibodies -
Description
Mouse monoclonal [1C5H11] to TGF beta Receptor III/TGFBR3 -
Host species
Mouse -
Tested applications
Suitable for: WB, ELISAmore details -
Species reactivity
Reacts with: Mouse, Human, Recombinant fragment
Predicted to work with: Chimpanzee, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human TGF beta Receptor III/TGFBR3 aa 147-328.
Sequence:ETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPK CNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYS AFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIA PNSIGFGKESERSMTMTKSIRDDIPSTQGNLV
-
Positive control
- Recombinant Human TGF beta Receptor III/TGFBR3 protein; Jurkat, HeLa, MCF7, F9, SK N SH, NIH 3T3 cell lysates.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR206347-9 are from Tissue Culture Supernatant
This product was previously labelled as TGF beta Receptor III
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer -
Concentration information loading... -
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
1C5H11 -
Isotype
IgG1 -
Research areas
Images
-
Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705) at 1/500 dilution + recombinant Human TGF beta Receptor III/TGFBR3 protein
Predicted band size: 93 kDa
Expected MW of recombinant protein is 44.1 kDa. -
All lanes : Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705) at 1/500 dilution
Lane 1 : Jurkat cell lysate
Lane 2 : HeLa cell lysate
Lane 3 : MCF7 cell lysate
Lane 4 : F9 cell lysate
Lane 5 : SK N SH cell lysate
Lane 6 : NIH 3T3 cell lysate
Predicted band size: 93 kDa
-
ELISA using ab166705 at 1/10000 dilution
Red: Control Antigen (100 ng)
Purple: Antigen (10 ng)
Green: Antigen (50 ng)
Blue: Antigen (100 ng)

