Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)

Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [1C5H11] to TGF beta Receptor III/TGFBR3
  • Suitable for: WB, ELISA
  • Reacts with: Mouse, Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Product image
Anti-Cullin 3/CUL-3 antibody (ab118960)
Product image
Anti-TRAF1 antibody [1F3] (ab252875)
Product image
Alexa Fluor® 594 Anti-PI3 Kinase p110 beta antibody [EPR5515(2)] (ab215509)
Product image
Alexa Fluor® 647 Anti-Apolipoprotein E antibody [EP1374Y] (ab196194)

Overview

  • Product name

    Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11]
    See all TGF beta Receptor III/TGFBR3 primary antibodies
  • Description

    Mouse monoclonal [1C5H11] to TGF beta Receptor III/TGFBR3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Human, Recombinant fragment
    Predicted to work with: Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TGF beta Receptor III/TGFBR3 aa 147-328.
    Sequence:

    ETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPK CNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYS AFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIA PNSIGFGKESERSMTMTKSIRDDIPSTQGNLV

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Recombinant Human TGF beta Receptor III/TGFBR3 protein; Jurkat, HeLa, MCF7, F9, SK N SH, NIH 3T3 cell lysates.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR206347-9 are from Tissue Culture Supernatant

     This product was previously labelled as TGF beta Receptor III

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    1C5H11
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Innate Immunity
    • Cytokines
    • Other
    • Stem Cells
    • Signaling Pathways
    • TGF beta
    • Surface Molecules

Images

  • Western blot - Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
    Western blot - Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
    Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705) at 1/500 dilution + recombinant Human TGF beta Receptor III/TGFBR3 protein

    Predicted band size: 93 kDa



    Expected MW of recombinant protein is 44.1 kDa.
  • Western blot - Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
    Western blot - Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
    All lanes : Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : MCF7 cell lysate
    Lane 4 : F9 cell lysate
    Lane 5 : SK N SH cell lysate
    Lane 6 : NIH 3T3 cell lysate

    Predicted band size: 93 kDa

  • ELISA - Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
    ELISA - Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)
    ELISA using ab166705 at 1/10000 dilution
    Red: Control Antigen (100 ng)
    Purple: Antigen (10 ng)
    Green: Antigen (50 ng)
    Blue: Antigen (100 ng)

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705)

  •  
  • Product image

    Anti-TGF beta Receptor III/TGFBR3 antibody [D11G10] (ab231012)

    Applications: IHC-P

  •  
  • Product image

    Anti-TGF beta Receptor III/TGFBR3 antibody (ab97459)

    Applications: WB

  •  
  • Anti-TGF beta Receptor III/TGFBR3 antibody (ab18885)

    Applications:

  •  
  • Product image

    Anti-TGF beta Receptor III/TGFBR3 antibody [MM0057-5G9] (ab78421)

    Applications: Flow Cyt, IHC-P

  •  
  • Product image

    Anti-TGF beta Receptor III/TGFBR3 antibody (ab224075)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-SPARCL1 antibody [EPR22615-277] (ab255597)

  •  
  • Product image

    Anti-PRAME antibody - BSA and Azide free (Capture) (ab244749)

  •  
  • Product image

    Anti-UMOD antibody - BSA and Azide free (Detector) (ab259582)

  •  
  • Anti-Integrin beta 3 antibody [25E11] - BSA and Azide free (ab212511)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.