Anti-SMCHD1 antibody (ab176731)
Key features and details
- Rabbit polyclonal to SMCHD1
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-SMCHD1 antibody
See all SMCHD1 primary antibodies -
Description
Rabbit polyclonal to SMCHD1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla -
Immunogen
Synthetic peptide within Human SMCHD1 aa 1955-2005. The exact sequence is proprietary. (NP_056110.2).
Sequence:IEEKLGMTPIRKCNDSLRHSPKVETTDCPVPPKRMRREATRQNRIITKTD V
Database link: A6NHR9 -
Positive control
- HeLa and 293T cell lysates; Human non-small cell lung cancer and testicular seminoma tissues.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6.8
Preservative: 0.09% Sodium azide
Constituents: 0.1% BSA, 99% Tris buffered saline -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab176731 is affinity purified using an epitope specific to SMCHD1 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-SMCHD1 antibody (ab176731) at 0.04 µg/ml
Lane 1 : HeLa whole cell lysate at 50 µg
Lane 2 : HeLa whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 5 µg
Lane 4 : 293T whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 226 kDa
Exposure time: 3 minutes
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMCHD1 antibody (ab176731)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testicular seminoma tissue labeling SMCHD1 with ab176731 at 1/200 dilution (1µg/ml). Detection: Peroxidase substrate.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SMCHD1 antibody (ab176731)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human non-small cell lung cancer tissue labeling SMCHD1 with ab176731 at 1/200 dilution (1µg/ml). Detection: Peroxidase substrate.
-
Detection of SMCHD1 in Immunoprecipitaties of HeLa whole cell lysate (1 mg for IP, 20% of IP loaded), using ab176731 at 3 µg/mg lysate for IP and at 0.4 µg/ml for subsequent Western blot detection.
Detection: Chemiluminescence with exposure time of 3 seconds.