Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Microbiology Interspecies Interaction Host Virus Interaction

Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Price and availability

278 083 ₸

Availability

Order now and get it on Tuesday March 02, 2021

Anti-SAMHD1 antibody [OTI1A1] (ab128107)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI1A1] to SAMHD1
  • Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
  • Knockout validated
  • Reacts with: Mouse, Rat, Dog, Human, African green monkey
  • Isotype: IgG2b

You may also be interested in

Product image
Anti-Pea3 antibody (ab98068)
Product image
Anti-Milk Fat Globule 1 antibody - BSA and Azide free (Capture) (ab242548)
Product image
Anti-VTA1 antibody (ab279583)
Product image
Anti-PCBP2/hnRNP E2 antibody [EPR14859(2)] - BSA and Azide free (ab251324)

Overview

  • Product name

    Anti-SAMHD1 antibody [OTI1A1]
    See all SAMHD1 primary antibodies
  • Description

    Mouse monoclonal [OTI1A1] to SAMHD1
  • Host species

    Mouse
  • Tested Applications & Species

    Application Species
    Flow Cyt
    Human
    ICC/IF
    African green monkey
    IHC-P
    Human
    WB
    Mouse
    Human
    See all applications and species data
  • Immunogen

    Recombinant full length protein corresponding to Human SAMHD1 aa 1-626. Produced in HEK-293T cells (NP_056289).
    Sequence:

    MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQV CSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKL LSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQL GGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQ IAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGI KPVMEQYGLIPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEI VSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRIC ARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEIT GAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEY RNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIV DVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLI RVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWND STSVQNPTRLREASKSRVQLFKDDPM


    Database link: Q9Y3Z3
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY SAMHD1 cDNA; HAP1, K562, HepG2, HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12, and MCF7 cell extracts; Mouse spleen extract. IHC-P: Human kidney, kidney carcinoma, liver, ovary adenocarcinoma, pancreas, thyroid carcinoma, prostate carcinoma, bladder carcinoma and tonsil tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY SAMHD1. Flow Cyt: HEK-293T cells transfected with pCMV6-ENTRY SAMHD1; HeLa and Jurkat cells.
  • General notes

    The clone number has been updated from 1A1 to OTI1A1, both clone numbers name the same antibody clone.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI1A1
  • Isotype

    IgG2b
  • Research areas

    • Microbiology
    • Interspecies Interaction
    • Host Virus Interaction
    • Microbiology
    • Interspecies Interaction
    • Host Immune Response

Images

  • Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Lane 1: Wild-type HAP1 cell lysate (20 µg)
    Lane 2: SAMHD1 knockout HAP1 cell lysate (20 µg)
    Lane 3: K562 cell lysate (20 µg)
    Lanes 1 - 3: Merged signal (red and green). Green - ab128107 observed at 70 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab128107 was shown to recognize SAMHD1 when SAMHD1 knockout samples were used, along with additional cross-reactive bands. Wild-type and SAMHD1 knockout samples were subjected to SDS-PAGE. ab128107 and ab181602 (loading control to GAPDH) were diluted 1/500 and 1/10 000 and incubated overnight at 4°C. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preadsorbed (ab216772) and Goat Anti-Rabbit IgG H&L (IRDye® 680RD) preadsorbed (ab216777) secondary antibodies at 1/10 000 dilution for 1 h at room temperature before imaging.

  • Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    All lanes : Anti-SAMHD1 antibody [OTI1A1] (ab128107) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SAMHD1 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 72 kDa

  • Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    All lanes : Anti-SAMHD1 antibody [OTI1A1] (ab128107) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : SVT2 cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (Canine kidney cell line) cell extract
    Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 72 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human kidney tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human kidney carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human liver tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human ovary adenocarcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human pancreas tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Anti-SAMHD1 antibody [OTI1A1] (ab128107) at 1/200 dilution + Mouse spleen extract at 10 µg

    Predicted band size: 72 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human thyroid carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human prostate carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human bladder carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Paraffin-embedded human tonsil tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.

  • Immunocytochemistry/ Immunofluorescence - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Immunocytochemistry/ Immunofluorescence - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY SAMHD1 cDNA  stained forSAMHD1 using ab128107 at 1/100 dilution in ICC/IF.

  • Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either pCMV6-ENTRY SAMHD1 overexpress plasmid (Red) or empty vector control plasmid (Blue) stained for SAMHD1 using ab128107 at 1/100 dilution.

  • Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SAMHD1 using ab128107 at 1/100 dilution (Red) compared to a nonspecific negative control (Blue).

  • Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)
    Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

    Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells stained for SAMHD1 using ab128107 at 1/100 dilution (Red) compared to a nonspecific negative control (Blue).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-SAMHD1 antibody [OTI1A1] (ab128107)

  •  
  • Product image

    Anti-SAMHD1 antibody (ab67820)

    Applications: WB

  •  
  • Product image

    Anti-SAMHD1 antibody (ab245389)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-SAMHD1 antibody (ab264335)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-SAMHD1 antibody [OTI1F9] (ab117908)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-SAMHD1 antibody [EPR13034] - N-terminal (ab191420)

    Applications: WB

  •  
  • Product image

    Anti-SAMHD1 antibody [EPR13040(B)] - C-terminal (ab177462)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-SAMHD1 antibody [EPR13040(B)] - BSA and Azide free (ab240199)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-CNPase antibody [11-5B] (ab6319)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.