Antibodies, Proteins, Kits and Reagents for Life Science

278 083 ₸ Product size

100 µl 278 083 ₸

Order now and get it on Tuesday March 02, 2021

Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Key features and details

Mouse monoclonal [OTI1A1] to SAMHD1
Suitable for: WB, IHC-P, Flow Cyt, ICC/IF
Knockout validated
Reacts with: Mouse, Rat, Dog, Human, African green monkey
Isotype: IgG2b

Product name

Anti-SAMHD1 antibody [OTI1A1]
See all SAMHD1 primary antibodies
Description

Mouse monoclonal [OTI1A1] to SAMHD1
Host species

Mouse

Tested Applications & Species

Application	Species
Flow Cyt	Human
ICC/IF	African green monkey
IHC-P	Human
WB	Mouse Human

See all applications and species data

Immunogen

Recombinant full length protein corresponding to Human SAMHD1 aa 1-626. Produced in HEK-293T cells (NP_056289).
Sequence:
MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQV CSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKL LSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQL GGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQ IAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGI KPVMEQYGLIPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEI VSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRIC ARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEIT GAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEY RNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIV DVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLI RVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWND STSVQNPTRLREASKSRVQLFKDDPM

Database link: Q9Y3Z3
Run BLAST with Run BLAST with
Positive control
- WB: HEK-293T cell lysate transfected with pCMV6-ENTRY SAMHD1 cDNA; HAP1, K562, HepG2, HeLa, SVT2, A549, COS-7, Jurkat, MDCK, PC-12, and MCF7 cell extracts; Mouse spleen extract. IHC-P: Human kidney, kidney carcinoma, liver, ovary adenocarcinoma, pancreas, thyroid carcinoma, prostate carcinoma, bladder carcinoma and tonsil tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY SAMHD1. Flow Cyt: HEK-293T cells transfected with pCMV6-ENTRY SAMHD1; HeLa and Jurkat cells.
General notes

The clone number has been updated from 1A1 to OTI1A1, both clone numbers name the same antibody clone.

Form

Liquid
Storage instructions

Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Storage buffer

pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol
Concentration information loading...
Purity

Affinity purified
Purification notes

Purified from cell culture supernatant.
Clonality

Monoclonal
Clone number

OTI1A1
Isotype

IgG2b
Research areas

Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Lane 1: Wild-type HAP1 cell lysate (20 µg)
Lane 2: SAMHD1 knockout HAP1 cell lysate (20 µg)
Lane 3: K562 cell lysate (20 µg)
Lanes 1 - 3: Merged signal (red and green). Green - ab128107 observed at 70 kDa. Red - loading control, ab181602, observed at 37 kDa.

ab128107 was shown to recognize SAMHD1 when SAMHD1 knockout samples were used, along with additional cross-reactive bands. Wild-type and SAMHD1 knockout samples were subjected to SDS-PAGE. ab128107 and ab181602 (loading control to GAPDH) were diluted 1/500 and 1/10 000 and incubated overnight at 4°C. Blots were developed with Goat anti-Mouse IgG H&L (IRDye^® 800CW) preadsorbed (ab216772) and Goat Anti-Rabbit IgG H&L (IRDye^® 680RD) preadsorbed (ab216777) secondary antibodies at 1/10 000 dilution for 1 h at room temperature before imaging.
Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

All lanes : Anti-SAMHD1 antibody [OTI1A1] (ab128107) at 1/500 dilution

Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY SAMHD1 cDNA

Lysates/proteins at 5 µg per lane.

Predicted band size: 72 kDa
Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

All lanes : Anti-SAMHD1 antibody [OTI1A1] (ab128107) at 1/500 dilution

Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : SVT2 cell extract
Lane 4 : A549 (human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (Canine kidney cell line) cell extract
Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract

Lysates/proteins at 35 µg per lane.

Predicted band size: 72 kDa
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human kidney tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human kidney carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human liver tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human ovary adenocarcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human pancreas tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Western blot - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Anti-SAMHD1 antibody [OTI1A1] (ab128107) at 1/200 dilution + Mouse spleen extract at 10 µg

Predicted band size: 72 kDa
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human thyroid carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human prostate carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human bladder carcinoma tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Paraffin-embedded human tonsil tissue stained for SAMHD1 using ab128107 at 1/150 dilution in immunohistochemical analysis.
Immunocytochemistry/ Immunofluorescence - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected with pCMV6-ENTRY SAMHD1 cDNA stained forSAMHD1 using ab128107 at 1/100 dilution in ICC/IF.
Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either pCMV6-ENTRY SAMHD1 overexpress plasmid (Red) or empty vector control plasmid (Blue) stained for SAMHD1 using ab128107 at 1/100 dilution.
Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for SAMHD1 using ab128107 at 1/100 dilution (Red) compared to a nonspecific negative control (Blue).
Flow Cytometry - Anti-SAMHD1 antibody [OTI1A1] (ab128107)

Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells stained for SAMHD1 using ab128107 at 1/100 dilution (Red) compared to a nonspecific negative control (Blue).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com