Anti-Proteasome subunit beta type 2/PSMB2 antibody (ab140426)
Key features and details
- Rabbit polyclonal to Proteasome subunit beta type 2/PSMB2
- Suitable for: WB, IP, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Proteasome subunit beta type 2/PSMB2 antibody
See all Proteasome subunit beta type 2/PSMB2 primary antibodies -
Description
Rabbit polyclonal to Proteasome subunit beta type 2/PSMB2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IP, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Rabbit, Guinea pig, Cow, Dog, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
-
Immunogen
Synthetic peptide corresponding to Human Proteasome subunit beta type 2/PSMB2 aa 151-201.
Sequence:ISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQG S
Database link: P49721 -
Positive control
- Recombinant Human Proteasome subunit beta type 2/PSMB2 protein (ab116169) can be used as a positive control in WB. 293T, HeLa and Jurkat whole cell lysates.
-
General notes
This product was previously labelled as PSMB2, Proteasome subunit beta type 2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7-8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab140426 was affinity purified using an epitope specific to Proteasome subunit beta type 2/PSMB2 immobilized on solid support. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-Proteasome subunit beta type 2/PSMB2 antibody (ab140426) at 0.1 µg/ml
Lane 1 : 293T whole cell lysate at 50 µg
Lane 2 : 293T whole cell lysate at 15 µg
Lane 3 : HeLa whole cell lysate at 50 µg
Lane 4 : Jurkat whole cell lysate at 50 µg
Developed using the ECL technique.
Predicted band size: 23 kDa
Exposure time: 30 seconds
-
Detection of Proteasome subunit beta type 2/PSMB2 in Immunoprecipitates of 293T whole cell lysates (1 mg for IP, 20% of IP loaded) using ab140426 at 6 µg/mg lysate for IP (Lane 1). Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 30 seconds. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Proteasome subunit beta type 2/PSMB2 antibody (ab140426)Immunohistochemistry of human ovarian carcinoma tissue using ab140426 at 1/5000.

