Anti-SLICK antibody [N11/33] (ab93602)
![Anti-SLICK antibody [N11/33] (ab93602)](https://www.abcam.com/ps/products/93/ab93602/Images/ab93602-310981-602a.png "Anti-SLICK antibody [N11/33] (ab93602)")
Key features and details
- Mouse monoclonal [N11/33] to SLICK
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG1
Overview
-
Product name
Anti-SLICK antibody [N11/33] -
Description
Mouse monoclonal [N11/33] to SLICK -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF MouseHumanIHC-P MouseWB Rat
-
Immunogen
Fusion protein corresponding to Mouse SLICK aa 564-624. (XP_920840)
Sequence:KNQDQQRKSNVSRSFYHGPSRLPVHSIIASMGTVAIDLQDTSCRATSGPT LALPSEGGKEL
-
Positive control
- ICC/IF: HaCaT cellsRat brain lysate. WB: Rat brain membrane lysate. IHC-P: Mouse back skin tissue.
-
General notes
The clone number has been updated from S11-33 to N11/33, both clone numbers name the same antibody clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N11/33 -
Isotype
IgG1 -
Research areas
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-SLICK antibody [N11/33] (ab93602)
100% methanol-fixed HaCaT (human keratinocyte cell line) cells stained for SLICK (green) using ab93602 at 1/100 dilution in ICC/IF. Secondary antibody is FITC Goat Anti-Mouse.
-
![Immunocytochemistry/ Immunofluorescence - Anti-SLICK antibody [N11/33] (ab93602)](https://www.abcam.com/ps/products/93/ab93602/Images/ab93602-2-ab93602icc.jpg)
Immunocytochemistry/ Immunofluorescence - Anti-SLICK antibody [N11/33] (ab93602)Immunohistochemical detection of SLICK in Mouse backskin sections using ab93602.
-
![Western blot - Anti-SLICK antibody [N11/33] (ab93602)](https://www.abcam.com/ps/products/93/ab93602/Images/ab93602-1-ab93602wb.jpg)
Western blot - Anti-SLICK antibody [N11/33] (ab93602)Western blot detection of KNCT2 in Rat brain membrane lysates using ab93602 at 1:1000 dilution. -
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLICK antibody [N11/33] (ab93602)](https://www.abcam.com/ps/products/93/ab93602/Images/ab93602-310982-602b.png)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-SLICK antibody [N11/33] (ab93602)Paraffin-embedded mouse back skin tissue stained for SLICK using ab93602 at 1/100 dilution in immunohistochemical analysis. Secondary antibody is FITC Goat Anti-Mouse.