Anti-KCNT1/SLACK antibody [N3/26] (ab94578)
![Anti-KCNT1/SLACK antibody [N3/26] (ab94578)](https://www.abcam.com/ps/products/94/ab94578/Images/ab94578-310075-anti-kcnt1-antibody-n3-26-western-blot.jpg "Anti-KCNT1/SLACK antibody [N3/26] (ab94578)")
Key features and details
- Mouse monoclonal [N3/26] to KCNT1/SLACK
- Suitable for: Flow Cyt, WB, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG1
Overview
-
Product name
Anti-KCNT1/SLACK antibody [N3/26]
See all KCNT1/SLACK primary antibodies -
Description
Mouse monoclonal [N3/26] to KCNT1/SLACK -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanIHC-P MouseWB Rat
-
Immunogen
Fusion protein corresponding to Rat KCNT1/SLACK aa 1168-1237.
Sequence:QDEMNDHHQNTLSYVLINPPPDTRLEPNDIVYLIRSDPLAHVTSSSQSRK SSCSNKLSSCNPETRDETQL
Database link: Q9Z258 -
Positive control
- Flow Cyt: SH-SY5Y cells. WB: Rat brain lysate.
-
General notes
The clone number has been updated from S3-26 to N3/26, both clone numbers name the same antibody clone.
This product was previously labelled as KCNT1
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: 50% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
N3/26 -
Isotype
IgG1 -
Research areas
Images
-
Western blot - Anti-KCNT1/SLACK antibody [N3/26] (ab94578)Anti-KCNT1/SLACK antibody [N3/26] (ab94578) at 1/1000 dilution + Rat brain lysate at 15 µg
Secondary
HRP-conjugated sheet anti-mouse IgG
Predicted band size: 137 kDaMembrane was blocked with 1.5% BSA for 30 minutes at room temperature. Primari antibody was incubated for 2 hours at room temperature.
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KCNT1/SLACK antibody [N3/26] (ab94578)](https://www.abcam.com/ps/products/94/ab94578/Images/ab94578-316178-anti-kcnt1-antibody-n3-26-immunohistochemistry.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-KCNT1/SLACK antibody [N3/26] (ab94578) -
![Flow Cytometry - Anti-KCNT1/SLACK antibody [N3/26] (ab94578)](https://www.abcam.com/ps/products/94/ab94578/Images/ab94578-109115-anti-kcnt1-antibody-n3-26-flow-cytometry.jpg)
Flow Cytometry - Anti-KCNT1/SLACK antibody [N3/26] (ab94578)Overlay histogram showing SH-SY5Y cells stained with ab94578 (red line). The cells were fixed with 4% paraformaldehyde (10 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab94578, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.
